mouse-LIPM

 
Mus musculus (Mouse) LIPM Lipm Lipl3 riken cdna 4632427c23 gene

Relationship
Block X
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 1 more: AK037214, BC031933, AK037091
1 UniProtTrembl : Q8K2A6
1 Interpro : Q8K2A6
1 Prodom : Q8K2A6
1 Pfam : Q8K2A6
1 PIRSF : Q8K2A6
1 SUPERFAM : Q8K2A6
1 QuickSwissBlast : Q8K2A6
1 ENSEMBL : ENSMUSG00000056078
 
Sequence
Graphical view for this peptide sequence: mouse-LIPM
Colored MSA for Acidic_Lipase (raw)
MSEILSRVWTVSHRVEIWLLILVAYLLQRNVNSGHLPTKAADPEAFMNVS
EIIKHKGYPSEEYEVATEDGYILSVNRIPRGQTRLKKEGSRPVVLLQHGL
LGDASNWISNLPNNSLGFILADAGFDVWMGNSRGNTWSRKHKTLSIDQDE
FWAFSYDEMARFDLPAVINFILQKTGQKKVYYVGYSQGTTMGFIAFSTMP
ELAHKIKMYFALAPIATVKYARSPGTKFLLLPDMMIKVLFGRQEFLYQTR
FFRQLFIYLCGQMILDQICSNIILLLGGFNTNNMNMSRANVYVAHTPAGT
SVQNILHWSQAVNSGELRAFDWGSETKNQEKCNQPTPIRYKVRDMMVPTA
MWTGGQDWLSNPDDVKTLLSEVTNLIYHKNIPEWAHVDFIWGLDAPQRVY
NEIIHLMKQEPNLPQGTCRVKL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSEILSRVWTVSHRVEIWLLILVAYLLQRNVNSGHLPTKAADPEAFMNVS
EIIKHKGYPSEEYEVATEDGYILSVNRIPRGQTRLKKEGSRPVVLLQHGL
LGDASNWISNLPNNSLGFILADAGFDVWMGNSRGNTWSRKHKTLSIDQDE
FWAFSYDEMARFDLPAVINFILQKTGQKKVYYVGYSQGTTMGFIAFSTMP
ELAHKIKMYFALAPIATVKYARSPGTKFLLLPDMMIKVLFGRQEFLYQTR
FFRQLFIYLCGQMILDQICSNIILLLGGFNTNNMNMSRANVYVAHTPAGT
SVQNILHWSQAVNSGELRAFDWGSETKNQEKCNQPTPIRYKVRDMMVPTA
MWTGGQDWLSNPDDVKTLLSEVTNLIYHKNIPEWAHVDFIWGLDAPQRVY
NEIIHLMKQEPNLPQGTCRVKL

no DNA




Reference
    Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
    Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R and Hayashizaki Y <127 more author(s)>
    Ref: Nature, 420:563, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer