Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-LIPN

Mus musculus (Mouse) lipase-like, ab-hydrolase domain containing 3 (fragment)

Relationship
Family|Acidic_Lipase
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AK154333, AC102119, AC165239
>3 UniProt links 1 more: Q3U4B4, D6RJJ5, D3YVB0
>3 UniProt links 1 more: Q3U4B4, D6RJJ5, D3YVB0
>3 Interpro links 1 more: Q3U4B4, D6RJJ5, D3YVB0
>3 Pfam links 1 more: Q3U4B4, D6RJJ5, D3YVB0
>3 PIRSF links 1 more: Q3U4B4, D6RJJ5, D3YVB0
>3 SUPERFAM links 1 more: Q3U4B4, D6RJJ5, D3YVB0
1 MGD : 1917416
1 ENSEMBL : ENSMUSG00000024770
Sequence
Graphical view for this peptide sequence: mouse-LIPN
Colored MSA for Acidic_Lipase (raw)
MPMMWLFLTTACLIPGTLSAGGFLDFENKVNPEVWMNASEIIMYNGYPSE
EYDVTTADGYILAINRIPHGRAQTGQTGPRPVVYMQHALFADNAYWLENF
ANGSLGFILADAGYDVWMGNSRGNTWSRRHKTLSANEEKFWAFSFNEMAK
YDLPGIIDFIVNKTGQEKLYFIGHSLGTTIGFVAFSTMPELAQRIKMNFA
LGPVISFKYPTSVFTNLFLLPKSIIKLVFGTKGVLLEDKNARMSFITFCN
QKLLQPLCSEFMSLWAGFNKKNMNMSRLDVYMAHAPTGSSIQNMLHIKQL
YRSDEFRAYDWGSEAENMNHYNQSYPPLYDLTAMKVPTAIWAGGHDVLVT
PQDVARILPQITNLRYFKQFPDWNHFDFVWGLDAPQRLYSKIISLMKEYF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPMMWLFLTTACLIPGTLSAGGFLDFENKVNPEVWMNASEIIMYNGYPSE
EYDVTTADGYILAINRIPHGRAQTGQTGPRPVVYMQHALFADNAYWLENF
ANGSLGFILADAGYDVWMGNSRGNTWSRRHKTLSANEEKFWAFSFNEMAK
YDLPGIIDFIVNKTGQEKLYFIGHSLGTTIGFVAFSTMPELAQRIKMNFA
LGPVISFKYPTSVFTNLFLLPKSIIKLVFGTKGVLLEDKNARMSFITFCN
QKLLQPLCSEFMSLWAGFNKKNMNMSRLDVYMAHAPTGSSIQNMLHIKQL
YRSDEFRAYDWGSEAENMNHYNQSYPPLYDLTAMKVPTAIWAGGHDVLVT
PQDVARILPQITNLRYFKQFPDWNHFDFVWGLDAPQRLYSKIISLMKEYF


References
3 more
    Title: Lineage-specific biology revealed by a finished genome assembly of the mouse
    Church DM, Goodstadt L, Hillier LW, Zody MC, Goldstein S, She X, Bult CJ, Agarwala R, Cherry JL and Ponting CP <21 more author(s)>
    Ref: PLoS Biol, 7:e1000112, 2009 : PubMed

            

    Title: The transcriptional landscape of the mammalian genome
    Carninci P, Kasukawa T, Katayama S, Gough J, Frith MC, Maeda N, Oyama R, Ravasi T, Lenhard B and Hayashizaki Y <184 more author(s)>
    Ref: Science, 309:1559, 2005 : PubMed

            

    Title: Functional annotation of a full-length mouse cDNA collection
    Kawai J, Shinagawa A, Shibata K, Yoshino M, Itoh M, Ishii Y, Arakawa T, Hara A, Fukunishi Y and Hayashizaki Y <86 more author(s)>
    Ref: Nature, 409:685, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer