mouse-LIPR2

 
Mus musculus mRNA for cytotoxic T lymphocyte lipase

Comment
Cytotoxic T lymphocyte lipase.Pancreatic lipase related protein 2 . old mouse-cttli


Relationship
Block L
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 1 more: M30687, M30687, BC094923
2 UniProt : P17892, Q4VBW7
1 Ncbi-nid : 192835
2 UniProtTrembl : P17892, Q4VBW7
2 Interpro : P17892, Q4VBW7
2 Prodom : P17892, Q4VBW7
2 Pfam : P17892, Q4VBW7
2 PIRSF : P17892, Q4VBW7
2 SUPERFAM : P17892, Q4VBW7
2 QuickSwissBlast : P17892, Q4VBW7
1 MGD : 1336202
2 ENSEMBL : P17892, ENSMUSG00000025091
 
Sequence
Graphical view for this peptide sequence: mouse-LIPR2
Colored MSA for Pancreatic_lipase (raw)
MLLCWLVSLLLATVGGKEVCYGHLGCFSNDKPWAGMIQRPSKIFPWSPED
IDTRFLLYTNENPNNYQIISATDPATINASNFQLDRKTRFIIHGFIDKGE
EGWLLDMCKKMFQVEKVNCICVDWKRGSRTEYTQASYNTRVLGAEIAFLV
QVLSTEMGYSPENVHLIPHSLGSHVAGEAGRRLEGHVGRITGLDPAEPCF
QGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQKVGHLDFFPNGGK
EIPGCQKNILSTIVDINGIWEGTRNFAACNHLRSYKYYASSILNPDGFLG
YPCSSYEKFQHNDCFPSPEQGCPKMGHYADQFEGKTATVEQTFFLNTADT
GNFTRWRYKVSVTLSGPKKLSGYILVALYGCNANSKQYEVFKGSLQPEAR
YIRDIDVDVNVGEIQKVKFLWNNKVINLFRPTMGASQITLQRAKDGKEFN
FCTSNTVHEDVLQSLYPC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLLCWLVSLLLATVGGKEVCYGHLGCFSNDKPWAGMIQRPSKIFPWSPED
IDTRFLLYTNENPNNYQIISATDPATINASNFQLDRKTRFIIHGFIDKGE
EGWLLDMCKKMFQVEKVNCICVDWKRGSRTEYTQASYNTRVLGAEIAFLV
QVLSTEMGYSPENVHLIPHSLGSHVAGEAGRRLEGHVGRITGLDPAEPCF
QGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQKVGHLDFFPNGGK
EIPGCQKNILSTIVDINGIWEGTRNFAACNHLRSYKYYASSILNPDGFLG
YPCSSYEKFQHNDCFPSPEQGCPKMGHYADQFEGKTATVEQTFFLNTADT
GNFTRWRYKVSVTLSGPKKLSGYILVALYGCNANSKQYEVFKGSLQPEAR
YIRDIDVDVNVGEIQKVKFLWNNKVINLFRPTMGASQITLQRAKDGKEFN
FCTSNTVHEDVLQSLYPC

Graphical view for this nucleotide DNA sequence (1600 bp): mouse-LIPR2



References
7 more
    Title: The suppression of pancreatic lipase-related protein 2 ameliorates experimental hepatic fibrosis in mice
    Ding Z, Cheng R, Liu J, Zhao Y, Ge W, Yang Y, Xu X, Wang S, Zhang J
    Ref: Biochimica & Biophysica Acta Molecular & Cellular Biology Lipids, 1867:159102, 2022 : PubMed

            

    Title: Kinetic properties of mouse pancreatic lipase-related protein-2 suggest the mouse may not model human fat digestion
    Xiao X, Ross LE, Miller RA, Lowe ME
    Ref: J Lipid Res, 52:982, 2011 : PubMed

            

    Title: Cloning of an interleukin-4 inducible gene from cytotoxic T lymphocytes and its identification as a lipase
    Grusby MJ, Nabavi N, Wong H, Dick RF, Bluestone JA, Schotz MC, Glimcher LH
    Ref: Cell, 60:451, 1990 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer