mouse-Ldah

 
Mus musculus (Mouse) lipid droplet-associated hydrolase (LDAH) C2orf43 CB043 UPF0554

Relationship
Block X
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 4 more: AK079099, AK076460, AK036177
1 UniProt : Q8BVA5
1 UniProtTrembl : Q8BVA5
1 Interpro : Q8BVA5
1 Prodom : Q8BVA5
1 Pfam : Q8BVA5
1 PIRSF : Q8BVA5
1 SUPERFAM : Q8BVA5
1 QuickSwissBlast : Q8BVA5
1 MGD : 1916082
1 ENSEMBL : ENSMUSG00000037669
 
Sequence
Graphical view for this peptide sequence: mouse-Ldah
Colored MSA for LIDHydrolase (raw)
MASEVEEQIPVREEFFLCGGVETKIIKCGPWTNLFEKQDVSKPKQLIFII
PGNPGYSAFYVPFAKALYTLMKSRFPVWIISHAGFSVTPKDKKVLAAPQE
ESNAQKIEDVYGLNGQIEHKIAFLRAHVPKDVKLILIGHSVGTYMTLHVM
KRVLELPVAHAFLLFPTIERMSESPNGKFATPFLCQFRYLLYATSYLLFK
PCPEVIKSFIIQKLMGQMNIKLELPLTDILQPFCLANAAYLGSQEMVQIV
KRDDDIIKEFLPKLKFYYGKTDGWCPVKYYEDMKKDFPEGNIYLCEKGIP
HAFVLDFSQEMATIVAEWINNRPPRK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASEVEEQIPVREEFFLCGGVETKIIKCGPWTNLFEKQDVSKPKQLIFII
PGNPGYSAFYVPFAKALYTLMKSRFPVWIISHAGFSVTPKDKKVLAAPQE
ESNAQKIEDVYGLNGQIEHKIAFLRAHVPKDVKLILIGHSVGTYMTLHVM
KRVLELPVAHAFLLFPTIERMSESPNGKFATPFLCQFRYLLYATSYLLFK
PCPEVIKSFIIQKLMGQMNIKLELPLTDILQPFCLANAAYLGSQEMVQIV
KRDDDIIKEFLPKLKFYYGKTDGWCPVKYYEDMKKDFPEGNIYLCEKGIP
HAFVLDFSQEMATIVAEWINNRPPRK

no DNA




References
    Title: Mice lacking lipid droplet-associated hydrolase, a gene linked to human prostate cancer, have normal cholesterol ester metabolism
    Kory N, Grond S, Kamat SS, Li Z, Krahmer N, Chitraju C, Zhou P, Frohlich F, Semova I and Walther TC <4 more author(s)>
    Ref: J Lipid Res, 58:226, 2017 : PubMed

            

    Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
    Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R and Hayashizaki Y <127 more author(s)>
    Ref: Nature, 420:563, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer