Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-MEST

Mus musculus Mouse and Mus musculus molossinus (Japanese house mouse) Mesoderm-specific transcript protein

Comment
Mesoderm-specific transcript (Mest) predominantly expressed in mesoderm and its derivatives is also an imprinted gene whose expression is dependent on parental origin and is designated Peg1 (paternally expressed gene-1). Identification and characterization of an imprinted antisense RNART (MESTIT1) in the human MEST locus on chromosome 7q32 PubMed 12095916. Q4L141_MUSMM Mus musculus molossinus (Japanese house mouse)


Relationship
Family|MEST-like
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: mouse-MEST
Colored MSA for MEST-like (raw)
MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKTSGKFF
TYKGLRIFYQDSVGVVGSPEIVVLLHGFPTSSYDWYKIWEGLTLRFHRVI
ALDFLGFGFSDKPRPHQYSIFEQASIVESLLRHLGLQNRRINLLSHDYGD
IVAQELLYRYKQNRSGRLTIKSLCLSNGGIFPETHRPLLLQKLLKDGGVL
SPILTRLMNFFVFSRGLTPVFGPYTRPTESELWDMWAVIRNNDGNLVIDS
LLQYINQRKKFRRRWVGALASVSIPIHFIYGPLDPINPYPEFLELYRKTL
PRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKTSGKFF
TYKGLRIFYQDSVGVVGSPEIVVLLHGFPTSSYDWYKIWEGLTLRFHRVI
ALDFLGFGFSDKPRPHQYSIFEQASIVESLLRHLGLQNRRINLLSHDYGD
IVAQELLYRYKQNRSGRLTIKSLCLSNGGIFPETHRPLLLQKLLKDGGVL
SPILTRLMNFFVFSRGLTPVFGPYTRPTESELWDMWAVIRNNDGNLVIDS
LLQYINQRKKFRRRWVGALASVSIPIHFIYGPLDPINPYPEFLELYRKTL
PRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF


References
10 more
    Title: Diet-induced adipose tissue expansion is mitigated in mice with a targeted inactivation of mesoderm specific transcript (Mest)
    Anunciado-Koza RP, Manuel J, Mynatt RL, Zhang J, Kozak LP, Koza RA
    Ref: PLoS ONE, 12:e0179879, 2017 : PubMed

            

    Title: Defective neuronal migration and inhibition of bipolar to multipolar transition of migrating neural cells by Mesoderm-Specific Transcript, Mest, in the developing mouse neocortex
    Ji L, Bishayee K, Sadra A, Choi S, Choi W, Moon S, Jho EH, Huh SO
    Ref: Neuroscience, 355:126, 2017 : PubMed

            

    Title: Adipose tissue Mest and Sfrp5 are concomitant with variations of adiposity among inbred mouse strains fed a non-obesogenic diet
    Anunciado-Koza RP, Higgins DC, Koza RA
    Ref: Biochimie, 124:134, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer