mouse-PPME1

 
Mus musculus (Mouse) similar to protein phosphatase methylesterase-1

Relationship
Block X
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic


Inhibitor: ABP-C6 , NBD-HE-HP ,
>3 Genbank links 5 more: BC014867, BC029064, AK076992
1 UniProt : Q8BVQ5
1 UniProtTrembl : Q8BVQ5
1 Interpro : Q8BVQ5
1 Prodom : Q8BVQ5
1 Pfam : Q8BVQ5
1 PIRSF : Q8BVQ5
1 SUPERFAM : Q8BVQ5
1 QuickSwissBlast : Q8BVQ5
1 MGD : 1919840
1 ENSEMBL : ENSMUSG00000030718
 
Sequence
Graphical view for this peptide sequence: mouse-PPME1
Colored MSA for PPase_methylesterase_euk (raw)
MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFTPVPWSQYF
ESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGGHSALSWAVFTAAII
SRVQCRIVALDLRGHGETKVKNSEDLSAETMAKDVGNVVEAMYGDLPPPV
MLIGHSMGGAIAVHTAAANLVPSLLGLCMIDVVEGTAMDALNSMQNFLRG
RPKTFKSLENAIEWSVKSGQIRNLESARVSMVGQVKQCEGITSPEGSKSI
VEGIIEEEEEDEEGSESVNKRKKEDDMETKKDHPYTWRIELAKTEKYWDG
WFRGLSNLFLSCPIPKLLLLAGVDRLDKDLTIGQMQGKFQMQVLPQCGHA
VHEDAPDKVAEAVATFLIRHRFAEPIGGFQCVFPGC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFTPVPWSQYF
ESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGGHSALSWAVFTAAII
SRVQCRIVALDLRGHGETKVKNSEDLSAETMAKDVGNVVEAMYGDLPPPV
MLIGHSMGGAIAVHTAAANLVPSLLGLCMIDVVEGTAMDALNSMQNFLRG
RPKTFKSLENAIEWSVKSGQIRNLESARVSMVGQVKQCEGITSPEGSKSI
VEGIIEEEEEDEEGSESVNKRKKEDDMETKKDHPYTWRIELAKTEKYWDG
WFRGLSNLFLSCPIPKLLLLAGVDRLDKDLTIGQMQGKFQMQVLPQCGHA
VHEDAPDKVAEAVATFLIRHRFAEPIGGFQCVFPGC

no DNA




References
1 more
    Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
    Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R and Hayashizaki Y <127 more author(s)>
    Ref: Nature, 420:563, 2002 : PubMed

            

    Title: Functional annotation of a full-length mouse cDNA collection
    Kawai J, Shinagawa A, Shibata K, Yoshino M, Itoh M, Ishii Y, Arakawa T, Hara A, Fukunishi Y and Hayashizaki Y <86 more author(s)>
    Ref: Nature, 409:685, 2001 : PubMed

            

    Title: A protein phosphatase methylesterase (PME-1) is one of several novel proteins stably associating with two inactive mutants of protein phosphatase 2A
    Ogris E, Du X, Nelson KC, Mak EK, Yu XX, Lane WS, Pallas DC
    Ref: Journal of Biological Chemistry, 274:14382, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer