Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-PPT2

Mus musculus (Mouse) palmitoyl-protein thioesterase 2

Relationship
Family|Palmitoyl-protein_thioesterase
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AF030001
1 UniProt : O35448
1 UniProt : O35448
1 Interpro : O35448
1 Pfam : O35448
1 PIRSF : O35448
1 SUPERFAM : O35448
1 MGD : 1860075
1 ENSEMBL : ENSMUSG00000015474
Sequence
Graphical view for this peptide sequence: mouse-PPT2
Colored MSA for Palmitoyl-protein_thioesterase (raw)
MPGLWRQRLPSAWALLLLPFLPLLMPAAPAAHRGSYKPVIVVHGLFDSSY
SFRHLLDYINETHTGTVVTVLDLFDGRESLRPLWEQVQGFREAVVPIMEK
APEGVHLICYSQGGLVCRALLSVMDNHNVDSFISLSSPQMGQYGDTDYLK
WLFPTSMRSNLYRVCYSPWGQEFSICNYWHDPHHDDLYLNASSFLALING
ERDHPNATAWRKNFLRVGRLVLIGGPDDGVITPWQSSFFGFYDANETVLE
MEEQPVYLRDSFGLKTLLARGAIVRCPMAGISHTTWHSNRTLYDTCIEPW
LS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPGLWRQRLPSAWALLLLPFLPLLMPAAPAAHRGSYKPVIVVHGLFDSSY
SFRHLLDYINETHTGTVVTVLDLFDGRESLRPLWEQVQGFREAVVPIMEK
APEGVHLICYSQGGLVCRALLSVMDNHNVDSFISLSSPQMGQYGDTDYLK
WLFPTSMRSNLYRVCYSPWGQEFSICNYWHDPHHDDLYLNASSFLALING
ERDHPNATAWRKNFLRVGRLVLIGGPDDGVITPWQSSFFGFYDANETVLE
MEEQPVYLRDSFGLKTLLARGAIVRCPMAGISHTTWHSNRTLYDTCIEPW
LS


References
    Title: Disruption of PPT2 in mice causes an unusual lysosomal storage disorder with neurovisceral features
    Gupta P, Soyombo AA, Shelton JM, Wilkofsky IG, Wisniewski KE, Richardson JA, Hofmann SL
    Ref: Proc Natl Acad Sci U S A, 100:12325, 2003 : PubMed

            

    Title: Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse
    Xie T, Rowen L, Aguado B, Ahearn ME, Madan A, Qin S, Campbell RD, Hood L
    Ref: Genome Res, 13:2621, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer