mouse-Q8BLF1

 
Mus musculus (Mouse) KIAA1363 NCEH1 neutral cholesterol ester hydrolase 1 B230106I24RIK

Comment
Trembl Q8BYQ0 is incomplete


Relationship
Block H
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 5 more: NP_848887, AK045363, AK038691
1 UniProt : Q3TVS3
3 UniProtTrembl : Q8BLF1, Q8BYQ0, Q3TVS3
3 Interpro : Q8BLF1, Q8BYQ0, Q3TVS3
3 Prodom : Q8BLF1, Q8BYQ0, Q3TVS3
3 Pfam : Q8BLF1, Q8BYQ0, Q3TVS3
3 PIRSF : Q8BLF1, Q8BYQ0, Q3TVS3
3 SUPERFAM : Q8BLF1, Q8BYQ0, Q3TVS3
3 QuickSwissBlast : Q8BLF1, Q8BYQ0, Q3TVS3
1 MGD : 2443191
1 ENSEMBL : ENSMUSG00000027698
 
Sequence
Graphical view for this peptide sequence: mouse-Q8BLF1
Colored MSA for Arylacetamide_deacetylase (raw)
MRSSCVLLAALLALAAYYVYIPLPSAVSDPWKLMLLDATFRGAQQVSNLI
HSLGLNHHLIALNFIITSFGKQSARSSPKVKVTDTDFDGVEVRVFEGSPK
PEEPLRRSVIYIHGGGWALASAKISYYDQLCTTMAEELNAVIVSIEYRLV
PQVYFPEQIHDVIRATKYFLQPEVLDKYKVDPGRVGISGDSAGGNLAAAL
GQQFTYVASLKNKLKLQALVYPVLQALDFNTPSYQQSMNTPILPRHVMVR
YWLDYFKGNYDFVEAMIVNNHTSLDVERAAALRARLDWTSLLPSSIKKNY
KPIMQTTGNARIVQEIPQLLDAAASPLIAEQEVLEALPKTYILTCEHDVL
RDDGIMYAKRLESAGVNVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNSY
IKWLDQNL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRSSCVLLAALLALAAYYVYIPLPSAVSDPWKLMLLDATFRGAQQVSNLI
HSLGLNHHLIALNFIITSFGKQSARSSPKVKVTDTDFDGVEVRVFEGSPK
PEEPLRRSVIYIHGGGWALASAKISYYDQLCTTMAEELNAVIVSIEYRLV
PQVYFPEQIHDVIRATKYFLQPEVLDKYKVDPGRVGISGDSAGGNLAAAL
GQQFTYVASLKNKLKLQALVYPVLQALDFNTPSYQQSMNTPILPRHVMVR
YWLDYFKGNYDFVEAMIVNNHTSLDVERAAALRARLDWTSLLPSSIKKNY
KPIMQTTGNARIVQEIPQLLDAAASPLIAEQEVLEALPKTYILTCEHDVL
RDDGIMYAKRLESAGVNVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNSY
IKWLDQNL

no DNA




References
6 more
    Title: A brain detoxifying enzyme for organophosphorus nerve poisons
    Nomura DK, Leung D, Chiang KP, Quistad GB, Cravatt BF, Casida JE
    Ref: Proc Natl Acad Sci U S A, 102:6195, 2005 : PubMed

            

    Title: Prediction of the coding sequences of mouse homologues of KIAA gene: IV. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries
    Okazaki N, R FK, Ohara R, Inamoto S, Koseki H, Hiraoka S, Saga Y, Seino S, Nishimura M and Koga H <5 more author(s)>
    Ref: DNA Research, 11:205, 2004 : PubMed

            

    Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
    Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R and Hayashizaki Y <127 more author(s)>
    Ref: Nature, 420:563, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer