Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-Q9DAI6

Mus musculus (Mouse) family active site containing protein, similarity 135, member B

Relationship
Family|Duf_676
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 4 more: AK005816, NM_027401, AC125528
2 UniProt : Q9DAI6, B2RPS5
2 UniProt : Q9DAI6, B2RPS5
2 Interpro : Q9DAI6, B2RPS5
2 Prodom : Q9DAI6, B2RPS5
2 Pfam : Q9DAI6, B2RPS5
2 PIRSF : Q9DAI6, B2RPS5
2 SUPERFAM : Q9DAI6, B2RPS5
1 MGD : 1917613
1 ENSEMBL : ENSMUSG00000022331
Sequence
Graphical view for this peptide sequence: mouse-Q9DAI6
Colored MSA for Duf_676 (raw)
MFSFYQAKEKFKKELKIEGFLYSDLSVLASDIPYFPPEEEEENLEDGIHL
VVCVHGLDGNSADLRLVKTFIELGLPGGKLDFLMSEKNQTDTFADFDTMT
DRLLDEIIQHIQLYNLSISRISFIGHSLGNIIIRSVLTRPRFRYYLNKLH
TFLSLSGPHLGTLYNNSTLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKC
FLYQLSQKTGLQYFKNVVLVASPQDRYVPFHSARIEMCKTALKDRHTGPV
YAEMINNLLGPLVEAKDCTLIRHNVFHALPNTANTLIGRAAHIAVLDSEL
FLEKFFLVAGLNYFK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MFSFYQAKEKFKKELKIEGFLYSDLSVLASDIPYFPPEEEEENLEDGIHL
VVCVHGLDGNSADLRLVKTFIELGLPGGKLDFLMSEKNQTDTFADFDTMT
DRLLDEIIQHIQLYNLSISRISFIGHSLGNIIIRSVLTRPRFRYYLNKLH
TFLSLSGPHLGTLYNNSTLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKC
FLYQLSQKTGLQYFKNVVLVASPQDRYVPFHSARIEMCKTALKDRHTGPV
YAEMINNLLGPLVEAKDCTLIRHNVFHALPNTANTLIGRAAHIAVLDSEL
FLEKFFLVAGLNYFK


References
4 more
    Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
    Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R and Hayashizaki Y <127 more author(s)>
    Ref: Nature, 420:563, 2002 : PubMed

            

    Title: Functional annotation of a full-length mouse cDNA collection
    Kawai J, Shinagawa A, Shibata K, Yoshino M, Itoh M, Ishii Y, Arakawa T, Hara A, Fukunishi Y and Hayashizaki Y <86 more author(s)>
    Ref: Nature, 409:685, 2001 : PubMed

            

    Title: High-efficiency full-length cDNA cloning
    Carninci P, Hayashizaki Y
    Ref: Methods Enzymol, 303:19, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer