Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-RISC

Mus musculus RISC retinoid-inducible serine carboxypeptidase HSCP1 (serine carboxypeptidase 1)

Comment
Trembl Q99J29 is one aa diff from AK014680 cdna 4833411k15 Trembl Q920A5 (RISC) Mus musculus (Mouse) retinoid-inducible serine carboxypeptidase in smouth muscle aorta and kidney


Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AK014680, BC004847, AF330052
3 UniProt : Q920A5, Q99J29, Q3U5P4
1 Ncbi-nid : 12852681
1 Ncbi-pid : 12852682
3 UniProt : Q920A5, Q99J29, Q3U5P4
3 Interpro : Q920A5, Q99J29, Q3U5P4
3 Prodom : Q920A5, Q99J29, Q3U5P4
3 Pfam : Q920A5, Q99J29, Q3U5P4
3 PIRSF : Q920A5, Q99J29, Q3U5P4
3 SUPERFAM : Q920A5, Q99J29, Q3U5P4
1 MGD : 1921867
2 ENSEMBL : Q9D625, ENSMUSG00000000278
Sequence
Graphical view for this peptide sequence: mouse-RISC
Colored MSA for Carboxypeptidase_S10 (raw)
MELSRRICLVRLWLLLLSFLLGFSAGSAIDWREPEGKEVWDYVTVRKDAH
MFWWLYYATNPCKNFSELPLVMWLQGGPGGSSTGFGNFEEIGPLDTQLKP
RNTTWLQWASLLFVDNPVGTGFSYVNTTDAYAKDLDTVASDMMVLLKSFF
DCHKEFQTVPFYIFSESYGGKMAAGISVELYKAVQQGTIKCNFSGVALGD
SWISPVDSVLSWGPYLYSMSLLDNQGLAEVSDIAEQVLDAVNKGFYKEAT
QLWGKAEMIIEKNTDGVNFYNILTKSSPEKAMESSLEFLRSPLVRLCQRH
VRHLQGDALSQLMNGPIKKKLKIIPEDISWGAQASYVFLSMEGDFMKPAI
DVVDKLLAAGVNVTVYNGQLDLIVDTIGQESWVQKLKWPQLSKFNQLKWK
ALYTDPKSSETAAFVKSYENLAFYWILKAGHMVPSDQGEMALKMMKLVTK
QE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MELSRRICLVRLWLLLLSFLLGFSAGSAIDWREPEGKEVWDYVTVRKDAH
MFWWLYYATNPCKNFSELPLVMWLQGGPGGSSTGFGNFEEIGPLDTQLKP
RNTTWLQWASLLFVDNPVGTGFSYVNTTDAYAKDLDTVASDMMVLLKSFF
DCHKEFQTVPFYIFSESYGGKMAAGISVELYKAVQQGTIKCNFSGVALGD
SWISPVDSVLSWGPYLYSMSLLDNQGLAEVSDIAEQVLDAVNKGFYKEAT
QLWGKAEMIIEKNTDGVNFYNILTKSSPEKAMESSLEFLRSPLVRLCQRH
VRHLQGDALSQLMNGPIKKKLKIIPEDISWGAQASYVFLSMEGDFMKPAI
DVVDKLLAAGVNVTVYNGQLDLIVDTIGQESWVQKLKWPQLSKFNQLKWK
ALYTDPKSSETAAFVKSYENLAFYWILKAGHMVPSDQGEMALKMMKLVTK
QE


References
1 more
    Title: Cloning of a novel retinoid-inducible serine carboxypeptidase from vascular smooth muscle cells
    Chen J, Streb JW, Maltby KM, Kitchen CM, Miano JM
    Ref: Journal of Biological Chemistry, 276:34175, 2001 : PubMed

            

    Title: Normalization and subtraction of cap-trapper-selected cDNAs to prepare full-length cDNA libraries for rapid discovery of new genes
    Carninci P, Shibata Y, Hayatsu N, Sugahara Y, Shibata K, Itoh M, Konno H, Okazaki Y, Muramatsu M, Hayashizaki Y
    Ref: Genome Res, 10:1617, 2000 : PubMed

            

    Title: High-efficiency full-length cDNA cloning
    Carninci P, Hayashizaki Y
    Ref: Methods Enzymol, 303:19, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer