Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-abhd1

Mus musculus (Mouse) lung alpha/beta hydrolase 1 (Labh1-pending)

Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AF189764, NM_021304, AK156413
1 UniProt : Q9QZC8
2 Ncbi-nid : 15011863, BC013505
1 Ncbi-pid : 15011864
1 UniProt : Q9QZC8
1 Interpro : Q9QZC8
1 Prodom : Q9QZC8
1 Pfam : Q9QZC8
1 PIRSF : Q9QZC8
1 SUPERFAM : Q9QZC8
1 EntrezGene : 57742
1 SNP : 57742
1 MGD : 1931013
2 ENSEMBL : Q9QZC8, ENSMUSG00000006638
Sequence
Graphical view for this peptide sequence: mouse-abhd1
Colored MSA for abh_upf0017 (raw)
MEYPYTTKMLSSSLSPQNGTWSDTISLLLALGVALYLGYYWACVPQRPRL
VAGPQFLAFLEQHCPVTVETFYPTLWCFEGRLQTIFRVLLQSQPVVPYRS
EVLQTPDGGQFLLDWAEQPNSTHYPDPTTQPIVLLLPGISGSSQEPYILH
LVNQALKDGYRAVVFNNRGCRGEELLTHRAYCASNTEDLETVVKHIKRRY
SQAPLLAVGISFGGILVLNYLAQTGKAGGLVAGLTMSACWDSFETVDSLE
TPLNSLLFNQPLTAGLCRLVARNRKPIEKVLDVDFAIKARTIRQLDERYT
SVAFGYKDCAAYYQAASPRTKVDAIHTPVLCLNAADDPFSPVHAFPLQAA
QKSPYVALLITARGGHIGFLEGLMPWQHCYMNRVLHQYARAIFQHSVGLP
DLGVLTPEDGKS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEYPYTTKMLSSSLSPQNGTWSDTISLLLALGVALYLGYYWACVPQRPRL
VAGPQFLAFLEQHCPVTVETFYPTLWCFEGRLQTIFRVLLQSQPVVPYRS
EVLQTPDGGQFLLDWAEQPNSTHYPDPTTQPIVLLLPGISGSSQEPYILH
LVNQALKDGYRAVVFNNRGCRGEELLTHRAYCASNTEDLETVVKHIKRRY
SQAPLLAVGISFGGILVLNYLAQTGKAGGLVAGLTMSACWDSFETVDSLE
TPLNSLLFNQPLTAGLCRLVARNRKPIEKVLDVDFAIKARTIRQLDERYT
SVAFGYKDCAAYYQAASPRTKVDAIHTPVLCLNAADDPFSPVHAFPLQAA
QKSPYVALLITARGGHIGFLEGLMPWQHCYMNRVLHQYARAIFQHSVGLP
DLGVLTPEDGKS


References
1 more
    Title: The transcriptional landscape of the mammalian genome
    Carninci P, Kasukawa T, Katayama S, Gough J, Frith MC, Maeda N, Oyama R, Ravasi T, Lenhard B and Hayashizaki Y <184 more author(s)>
    Ref: Science, 309:1559, 2005 : PubMed

            

    Title: Cloning and tissue distribution of three murine alpha/beta hydrolase fold protein cDNAs
    Edgar AJ, Polak JM
    Ref: Biochemical & Biophysical Research Communications, 292:617, 2002 : PubMed

            

    Title: LABH-1: cloning of a novel alpha/beta hydrolase fold protein from mouse lung in Proceedings of the Anatomical Society of Great Britain and Ireland
    Edgar AJ, Polak JM
    Ref: Journal of Anatomy, 197:320, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer