Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-abhd3

Mus musculus (Mouse) lung alpha/beta hydrolase fold protein 3

Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
1 inhbitor:
MIDA-ester-4j
>3 Genbank links 2 more: AF429302, BC026770, AK144238
1 UniProt : Q91ZH7
1 UniProt : Q91ZH7
1 Interpro : Q91ZH7
1 Prodom : Q91ZH7
1 Pfam : Q91ZH7
1 PIRSF : Q91ZH7
1 SUPERFAM : Q91ZH7
1 MGD : 2147183
2 ENSEMBL : Q91ZH7, ENSMUSG00000002475
Sequence
Graphical view for this peptide sequence: mouse-abhd3
Colored MSA for abh_upf0017 (raw)
MQRLAMDLRVLSRELALYLEHQVRVGFFGSGVGLSLILGFSVAYACYYLS
SIAKKPQLVIGGESFSRFLQDHCPVVTETYYPTVWCWESRGQTLLRPFIT
SKPPVQYRNELIKTADGGQISLDWFDNNNSAYYVDASTRPTILLLPGLTG
TSKESYILHMIHLSEELGYRCVVFNNRGVAGESLLTPRTYCCANTEDLEA
VVHHVHSLYPGAPFLAAGVSMGGMLLLNYLGKIGSKTPLMAAATFSVGWN
TFACSESLERPLNWLLFNYYLTTCLQSSVKKHRHMFVEQIDMDQVMKAKS
IREFDKRFTAVMFGYRTLDDYYTDASPNRRLKSVGIPVLCLNATDDVFSP
SHAIPIETAKQNPNVALVLTAYGGHIGFLEGIWPRQCTYMDRVFKQFVQA
MVEHGHELSNM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQRLAMDLRVLSRELALYLEHQVRVGFFGSGVGLSLILGFSVAYACYYLS
SIAKKPQLVIGGESFSRFLQDHCPVVTETYYPTVWCWESRGQTLLRPFIT
SKPPVQYRNELIKTADGGQISLDWFDNNNSAYYVDASTRPTILLLPGLTG
TSKESYILHMIHLSEELGYRCVVFNNRGVAGESLLTPRTYCCANTEDLEA
VVHHVHSLYPGAPFLAAGVSMGGMLLLNYLGKIGSKTPLMAAATFSVGWN
TFACSESLERPLNWLLFNYYLTTCLQSSVKKHRHMFVEQIDMDQVMKAKS
IREFDKRFTAVMFGYRTLDDYYTDASPNRRLKSVGIPVLCLNATDDVFSP
SHAIPIETAKQNPNVALVLTAYGGHIGFLEGIWPRQCTYMDRVFKQFVQA
MVEHGHELSNM


References
2 more
    Title: Multicomponent mapping of boron chemotypes furnishes selective enzyme inhibitors
    Tan J, Cognetta AB, 3rd, Diaz DB, Lum KM, Adachi S, Kundu S, Cravatt BF, Yudin AK
    Ref: Nat Commun, 8:1760, 2017 : PubMed

            

    Title: Metabolomics annotates ABHD3 as a physiologic regulator of medium-chain phospholipids
    Long JZ, Cisar JS, Milliken D, Niessen S, Wang C, Trauger SA, Siuzdak G, Cravatt BF
    Ref: Nat Chemical Biology, 7:763, 2011 : PubMed

            

    Title: Cloning and tissue distribution of three murine alpha/beta hydrolase fold protein cDNAs
    Edgar AJ, Polak JM
    Ref: Biochemical & Biophysical Research Communications, 292:617, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer