Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-abhda

Mus musculus (Mouse) Abhydrolase domain-containing protein 10, mitochondrial

Comment
Q8K188 short fragment


Relationship
Family|ABHD10
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
6NY9: Alpha/beta hydrolase domain-containing protein 10 from mouse
No kinetic





3 substrates: Depalmitoylation-probe-2, Depalmitoylation-probe-5, mitoDPP-2
2 inhibitors: 2-methyl-pentane-2,4-diol, mitoFP
>3 Genbank links 5 more: AK052670, BC027656, NM_172511
1 UniProt : Q6PE15
1 Structure : 6NY9
>3 UniProt links 2 more: Q6PE15, Q3TMB4, Q8C3S8
>3 Interpro links 2 more: Q6PE15, Q3TMB4, Q8C3S8
>3 Prodom links 2 more: Q6PE15, Q3TMB4, Q8C3S8
>3 Pfam links 2 more: Q6PE15, Q3TMB4, Q8C3S8
>3 PIRSF links 2 more: Q6PE15, Q3TMB4, Q8C3S8
>3 SUPERFAM links 2 more: Q6PE15, Q3TMB4, Q8C3S8
1 MGD : 2442422
1 ENSEMBL : ENSMUSG00000033157
Sequence
Graphical view for this peptide sequence: mouse-abhda
Colored MSA for ABHD10 (raw)
MAAWAPCRRWGWAAVSFGRHPGLSASLARKPPRAWWLSACRQKASLSFLN
RSELPNLAYKRLKGKTPGIIFIPGYLSNMNGIKAVAVEEFCKSLGHAFIR
FDYSGIGSSDGNLAECTVGKWRKDVLSILDDVAEGPQILVGSSLGGWLML
HAAIARPEKVIALIGIATAADGLVTQYHALPVETQKEIEMKGEWTLPSRY
NKEGYFRIPYSFIKEAEHHCLLHSPIPVTCPVRLLHGMKDEIVPWQRSLQ
VADRIVSPDVDVILRKRGDHRMKEKADIHLLICTIDDLIDKLSTVVP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAAWAPCRRWGWAAVSFGRHPGLSASLARKPPRAWWLSACRQKASLSFLN
RSELPNLAYKRLKGKTPGIIFIPGYLSNMNGIKAVAVEEFCKSLGHAFIR
FDYSGIGSSDGNLAECTVGKWRKDVLSILDDVAEGPQILVGSSLGGWLML
HAAIARPEKVIALIGIATAADGLVTQYHALPVETQKEIEMKGEWTLPSRY
NKEGYFRIPYSFIKEAEHHCLLHSPIPVTCPVRLLHGMKDEIVPWQRSLQ
VADRIVSPDVDVILRKRGDHRMKEKADIHLLICTIDDLIDKLSTVVP


References
2 more
    Title: ABHD10 is an S-depalmitoylase affecting redox homeostasis through peroxiredoxin-5
    Cao Y, Qiu T, Kathayat RS, Azizi SA, Thorne AK, Ahn D, Fukata Y, Fukata M, Rice PA, Dickinson BC
    Ref: Nat Chemical Biology, 15:1232, 2019 : PubMed

            

    Title: An Orphan Esterase ABHD10 Modulates Probenecid Acyl Glucuronidation in Human Liver
    Ito Y, Fukami T, Yokoi T, Nakajima M
    Ref: Drug Metabolism & Disposition: The Biological Fate of Chemicals, 42:2109, 2014 : PubMed

            

    Title: Human alpha/beta hydrolase domain containing 10 (ABHD10) is responsible enzyme for deglucuronidation of mycophenolic acid acyl-glucuronide in liver
    Iwamura A, Fukami T, Higuchi R, Nakajima M, Yokoi T
    Ref: Journal of Biological Chemistry, 287:9240, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer