Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-acot1

Mus musculus (Mouse) hydrolase) ACOT1 (cte-I) cytosolic long chain Acyl-CoA thioesterase

Comment
The mouse ACOT gene cluster comprises six genes with localizations in cytosol (ACOT1), mitochondria (ACOT2), and peroxisomes (ACOT3-6). The corresponding human gene cluster contains only three genes (ACOT1, ACOT2, and ACOT4) coding for full-length thioesterase proteins only ACOT4 is peroxisomal


Relationship
Family|Acyl-CoA_Thioesterase
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 4 more: AAH28261, Y14004, BC028261
3 UniProt : Q99L15, O55137, Q549A9
2 UniProt : O55137, Q99L15
2 Interpro : O55137, Q99L15
2 Prodom : O55137, Q99L15
2 Pfam : O55137, Q99L15
2 PIRSF : O55137, Q99L15
2 SUPERFAM : O55137, Q99L15
1 MGD : 1349396
Sequence
Graphical view for this peptide sequence: mouse-acot1
Colored MSA for Acyl-CoA_Thioesterase (raw)
MEATLNLEPSGRSCWDEPLSIAVRGLAPEQPVTLRSVLRDEKGALFRAHA
RYRADSHGELDLARTPALGGSFSGLEPMGLLWAMEPDRPFWRLVKRDVQT
PFVVELEVLDGHEPDGGQRLAHAVHERHFLAPGVRRVPVREGRVRATLFL
PPEPGPFPGIIDLFGVGGGLLEYRASLLAGKGFAVMALAYYNYDDLPKNM
ETMHMEYFEEAVNYLRSHPEVKGPGIGLLGISKGGELGLAMASFLKGITA
AVVINGSVAAVGNTISYKDETIPPVTILRNQVKMTKDGLKDVVDALQSPL
VDKKSFIPVERSDTTFLFLVGQDDHNWKSEFYADEISKRLQAHGKEKPQI
ICYPAAGHYIEPPYFPLCSAGMHLLVGANITFGGEPKPHAMAQLDAWQQL
QTFFHKQLGSECLHVSPKI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEATLNLEPSGRSCWDEPLSIAVRGLAPEQPVTLRSVLRDEKGALFRAHA
RYRADSHGELDLARTPALGGSFSGLEPMGLLWAMEPDRPFWRLVKRDVQT
PFVVELEVLDGHEPDGGQRLAHAVHERHFLAPGVRRVPVREGRVRATLFL
PPEPGPFPGIIDLFGVGGGLLEYRASLLAGKGFAVMALAYYNYDDLPKNM
ETMHMEYFEEAVNYLRSHPEVKGPGIGLLGISKGGELGLAMASFLKGITA
AVVINGSVAAVGNTISYKDETIPPVTILRNQVKMTKDGLKDVVDALQSPL
VDKKSFIPVERSDTTFLFLVGQDDHNWKSEFYADEISKRLQAHGKEKPQI
ICYPAAGHYIEPPYFPLCSAGMHLLVGANITFGGEPKPHAMAQLDAWQQL
QTFFHKQLGSECLHVSPKI


References
3 more
    Title: The peroxisome proliferator-induced cytosolic type I acyl-CoA thioesterase (CTE-I) is a serine-histidine-aspartic acid alpha/beta hydrolase
    Huhtinen K, O'Byrne J, Lindquist PJ, Contreras JA, Alexson SE
    Ref: Journal of Biological Chemistry, 277:3424, 2001 : PubMed

            

    Title: Peroxisome proliferator-induced long chain acyl-CoA thioesterases comprise a highly conserved novel multi-gene family involved in lipid metabolism
    Hunt MC, Nousiainen SE, Huttunen MK, Orii KE, Svensson LT, Alexson SE
    Ref: Journal of Biological Chemistry, 274:34317, 1999 : PubMed

            

    Title: Molecular cloning of the peroxisome proliferator-induced 46-kDa cytosolic acyl-CoA thioesterase from mouse and rat liver--recombinant expression in Escherichia coli, tissue expression, and nutritional regulation.
    Lindquist PJG, Svensson TL, Alexson SEH
    Ref: European Journal of Biochemistry, 251:631, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer