mouse-adcl4

 
Mus musculus (Mouse) Arylacetamide deacetylase-like 4 Hypothetical esterase/lipase/thioesterase family active site containing protein

Relationship
Block H
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : AK034567, NM_198662
2 UniProt : Q8BM81, A7E1Z3
2 UniProtTrembl : Q8BM81, A7E1Z3
2 Interpro : Q8BM81, A7E1Z3
2 Prodom : Q8BM81, A7E1Z3
2 Pfam : Q8BM81, A7E1Z3
2 PIRSF : Q8BM81, A7E1Z3
2 SUPERFAM : Q8BM81, A7E1Z3
2 QuickSwissBlast : Q8BM81, A7E1Z3
1 ENSEMBL : ENSMUSG00000028593
 
Sequence
Graphical view for this peptide sequence: mouse-adcl4
Colored MSA for Arylacetamide_deacetylase (raw)
MLYLVGFLLATVCLLVLGVNVWVLIDHFLTIDVPPSIPHPVKFRILHFCF
HLTTTWGHILEKMNICSMPQFFCFLQDSLSSKENHGVFVKDLRFGTIPVR
LFRPKAASSKPRRGILFFHGGGAMIGSLDSHHNLCTFLARETDSVLVSVG
YRKLPYYHHPSLYHDCINASIHFLKSLKAYGIDPSRVVICGESIGGAAAV
VVTQTLLSRTDIPKIRAQVLIYPILQAFYFQSPSHLMHKNIPFLTKDFMI
TCICKYLAIDFSWKDAMLTGACISPSAWKKYEKWLSPDNIPKRFRTTYQP
PESPAPFNEAAYLETKHAMNIDISPLVADDKIIAQLPEAFLVSLHWDIIR
DDVLLYKKRLEDQGVPVTWHHVEDGFHGCILLFDKKLFSFPCSLNIVNAV
VSYIKDL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLYLVGFLLATVCLLVLGVNVWVLIDHFLTIDVPPSIPHPVKFRILHFCF
HLTTTWGHILEKMNICSMPQFFCFLQDSLSSKENHGVFVKDLRFGTIPVR
LFRPKAASSKPRRGILFFHGGGAMIGSLDSHHNLCTFLARETDSVLVSVG
YRKLPYYHHPSLYHDCINASIHFLKSLKAYGIDPSRVVICGESIGGAAAV
VVTQTLLSRTDIPKIRAQVLIYPILQAFYFQSPSHLMHKNIPFLTKDFMI
TCICKYLAIDFSWKDAMLTGACISPSAWKKYEKWLSPDNIPKRFRTTYQP
PESPAPFNEAAYLETKHAMNIDISPLVADDKIIAQLPEAFLVSLHWDIIR
DDVLLYKKRLEDQGVPVTWHHVEDGFHGCILLFDKKLFSFPCSLNIVNAV
VSYIKDL

no DNA




References
    Title: The transcriptional landscape of the mammalian genome
    Carninci P, Kasukawa T, Katayama S, Gough J, Frith MC, Maeda N, Oyama R, Ravasi T, Lenhard B and Hayashizaki Y <184 more author(s)>
    Ref: Science, 309:1559, 2005 : PubMed

            

    Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)
    Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R and Malek J <104 more author(s)>
    Ref: Genome Res, 14:2121, 2004 : PubMed

            

    Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
    Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R and Hayashizaki Y <127 more author(s)>
    Ref: Nature, 420:563, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer