Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-aryla

Mus musculus (Mouse) arylacetamide deacetylase and 5033417e09rik protein

Comment
Displays cellular triglyceride lipase activity in liver, increases the levels of intracellular fatty acids derived from the hydrolysis of newly formed triglyceride stores and plays a role in very low-density lipoprotein assembly (By similarity). Displays serine esterase activity in liver. Deacetylates a variety of arylacetamide substrates, including xenobiotic compounds and procarcinogens, converting them to the primary arylamide compounds and increasing their toxicity


Relationship
Family|Arylacetamide_deacetylase
Block| H
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
1 inhbitor:
ABP-C6
>3 Genbank links 1 more: AK008244, AF306788, BC019999
1 UniProt : Q99PG0
2 UniProt : Q99PG0, Q8VCF2
2 Interpro : Q99PG0, Q8VCF2
2 Prodom : Q99PG0, Q8VCF2
2 Pfam : Q99PG0, Q8VCF2
2 PIRSF : Q99PG0, Q8VCF2
2 SUPERFAM : Q99PG0, Q8VCF2
1 MGD : 1915008
2 ENSEMBL : Q99PG0, ENSMUSG00000027761
Sequence
Graphical view for this peptide sequence: mouse-aryla
Colored MSA for Arylacetamide_deacetylase (raw)
MGKTISLLISVVLVAYYLYIPLPDAIEEPWKVVWETAFVKIGTDLASFGE
LLGISHFMETIQLLMSFQEVPPTSDEHVTVMETAFDSVPVRIYIPKRKSM
ALRRGLFYIHGGGWCLGSAAHFSYDTLSRWTAHKLDAVVVSTDYGLAPKH
HFPRQFEDVYRSLRWFLQEDVLEKYGVDPRRVGVSGDSAGGNLAAAVTQQ
LIQDPDVKIKLKVQALIYPALQALDTNVPSQQEGSHFPVLTRSLMVRFWS
EYFTTDRGLEKAMLLNQHVPMESSHLLQFVNWSSLLPERYKKSPVYKNPT
PGSSELAQKYPGFIDVKACPLLANDNILHHLPKTYIITCQYDVLRDDGLM
YVKRLQNVGVHVTHHHVEDGFHGTFSFPGLKLSERMKNQYLSWLIKNL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGKTISLLISVVLVAYYLYIPLPDAIEEPWKVVWETAFVKIGTDLASFGE
LLGISHFMETIQLLMSFQEVPPTSDEHVTVMETAFDSVPVRIYIPKRKSM
ALRRGLFYIHGGGWCLGSAAHFSYDTLSRWTAHKLDAVVVSTDYGLAPKH
HFPRQFEDVYRSLRWFLQEDVLEKYGVDPRRVGVSGDSAGGNLAAAVTQQ
LIQDPDVKIKLKVQALIYPALQALDTNVPSQQEGSHFPVLTRSLMVRFWS
EYFTTDRGLEKAMLLNQHVPMESSHLLQFVNWSSLLPERYKKSPVYKNPT
PGSSELAQKYPGFIDVKACPLLANDNILHHLPKTYIITCQYDVLRDDGLM
YVKRLQNVGVHVTHHHVEDGFHGTFSFPGLKLSERMKNQYLSWLIKNL


References
3 more
    Title: Arylacetamide deacetylase knockout mice are sensitive to ketoconazole-induced hepatotoxicity and adrenal insufficiency
    Nagaoka M, Fukami T, Kisui F, Yamada T, Sakai Y, Tashiro K, Ogiso T, Konishi K, Honda S and Nakajima M <2 more author(s)>
    Ref: Biochemical Pharmacology, 195:114842, 2022 : PubMed

            

    Title: Functional annotation of a full-length mouse cDNA collection
    Kawai J, Shinagawa A, Shibata K, Yoshino M, Itoh M, Ishii Y, Arakawa T, Hara A, Fukunishi Y and Hayashizaki Y <86 more author(s)>
    Ref: Nature, 409:685, 2001 : PubMed

            

    Title: Characterization of the rodent genes for arylacetamide deacetylase, a putative microsomal lipase, and evidence for transcriptional regulation
    Trickett JI, Patel DD, Knight BL, Saggerson ED, Gibbons GF, Pease RJ
    Ref: Journal of Biological Chemistry, 276:39522, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer