Gene_Locus Report
Biblio print
Add to basket
Go to basket
Tree Display
AceDB Schema
XML Display
Feedback

Gene_locus Report for: mouse-bphl

Mus musculus (Mouse) biphenyl hydrolase-like, breast epithelial mucin-assoc AG BPHL (mcnaa), Valacyclovir hydrolase 2010012d11 rik protein

Comment
Trembl Q9DCC6 and Trembl Q9CYD0 (now obsolete) differ only in C-term possible alternativ spicing? ( 5730533b08rik and 2010012d11rik and 3 aa diff from Strausberg R et al seq Q8R164. Q8BVH2 (Okazaki) differs by 3aa Q8C1P4 same name but 7 aa diff incomplete


Relationship
Family|Valacyclovir-hydrolase
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





2 substrates: Valacyclovir, Valgancyclovir
No inhibitor
>3 Genbank links 7 more: NM_026512, AK078232, BC025162
2 UniProt : Q8R164, Q3TDN8
3 UniProt : Q8R164, Q8C1P4, Q3TDN8
3 Interpro : Q8R164, Q8C1P4, Q3TDN8
3 Pfam : Q8R164, Q8C1P4, Q3TDN8
3 PIRSF : Q8R164, Q8C1P4, Q3TDN8
3 SUPERFAM : Q8R164, Q8C1P4, Q3TDN8
2 MGD : 1917920, 1915271
1 ENSEMBL : ENSMUSG00000038286
Sequence
Peptide
Graphical view for this peptide sequence: mouse-bphl
Colored MSA for Valacyclovir-hydrolase (raw) 
MATATVRPAAQRLRLLLSPLKSRICVPQAEPVATFGTAVTSAKVAVNGVH
LHYQRVGEGEHAILLLPGMLGSGKTDFAPQLQSLNKKRFTLVAWDPRGYG
YSRPPDRDFPRDFFERDAKDAVDLMKALQFKQVSLLGWSDGGITALIAAA
KYPSYIRKMVIWGANAYVTEEDSRIYQGIRDVSKWSEKARKPLEALYGYD
YLAKTCEDWVDGISQFKHCPEGNICRHLLPLVQCPTLIVHGEKDPLVPRF
HADFLLQHVKGSRLHLMPEGKHNLHLRFADEFNRLVEDFFQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MATATVRPAAQRLRLLLSPLKSRICVPQAEPVATFGTAVTSAKVAVNGVH
LHYQRVGEGEHAILLLPGMLGSGKTDFAPQLQSLNKKRFTLVAWDPRGYG
YSRPPDRDFPRDFFERDAKDAVDLMKALQFKQVSLLGWSDGGITALIAAA
KYPSYIRKMVIWGANAYVTEEDSRIYQGIRDVSKWSEKARKPLEALYGYD
YLAKTCEDWVDGISQFKHCPEGNICRHLLPLVQCPTLIVHGEKDPLVPRF
HADFLLQHVKGSRLHLMPEGKHNLHLRFADEFNRLVEDFFQ

References
    Title: Lineage-specific biology revealed by a finished genome assembly of the mouse
    Church DM, Goodstadt L, Hillier LW, Zody MC, Goldstein S, She X, Bult CJ, Agarwala R, Cherry JL and Ponting CP <21 more author(s)>
    Ref: PLoS Biol, 7:e1000112, 2009 : PubMed

            

    Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
    Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R and Hayashizaki Y <127 more author(s)>
    Ref: Nature, 420:563, 2002 : PubMed

            

    Title: Functional annotation of a full-length mouse cDNA collection
    Kawai J, Shinagawa A, Shibata K, Yoshino M, Itoh M, Ishii Y, Arakawa T, Hara A, Fukunishi Y and Hayashizaki Y <86 more author(s)>
    Ref: Nature, 409:685, 2001 : PubMed

            


Other Papers

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer