mouse-dpp9

 
Mus musculus (Mouse) dipeptidyl peptidase 9 homolog mflj00334 protein

Comment
has dpp activity similar to dpp4


Relationship
Block X
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 1 more: AK078301, AK131178, AK050021
1 UniProt : Q8BVG4
1 UniProtTrembl : Q8BVG4
1 Interpro : Q8BVG4
1 Prodom : Q8BVG4
1 Pfam : Q8BVG4
1 PIRSF : Q8BVG4
1 SUPERFAM : Q8BVG4
1 QuickSwissBlast : Q8BVG4
1 MGD : 2443967
1 ENSEMBL : ENSMUSG00000001229
 
Sequence
Graphical view for this peptide sequence: mouse-dpp9
Colored MSA for DPP4N_Peptidase_S9 (raw)
MCSGVSPVEQVAAGDMDDTAARFCVQKHSWDGLRSIIHGSRKSSGLIVSK
APHDFQFVQKPDESGPHSHRLYYLGMPYGSRENSLLYSEIPKKVRKEALL
LLSWKQMLDHFQATPHHGVYSREEELLRERKRLGVFGITSYDFHSESGLF
LFQASNSLFHCRDGGKNGFMVSPMKPLEIKTQCSGPRMDPKICPADPAFF
SFINNSDLWVANIETGEERRLTFCHQGSAGVLDNPKSAGVATFVIQEEFD
RFTGCWWCPTASWEGSEGLKTLRILYEEVDESEVEVIHVPSPALEERKTD
SYRYPRTGSKNPKIALKLAELQTDHQGKIVSSCEKELVQPFSSLFPKVEY
IARAGWTRDGKYAWAMFLYRPQQRLQLVLLPPALFIPAVESEAQRQAAAR
AVPKNVQPFVIYEEVTNVWINVHDIFHPFPQAEGQQDFCFLRANECKTGF
CHLYRVTVELKTKDYDWTEPLSPTEDEFKCPIKEEVALTSGEWEVLSRHG
SKIWVNEQTKLVYFQGTKDTPLEHHLYVVSYESAGEIVRLTTLGFSHSCS
MSQSFDMFVSHYSSVSTPPCVHVYKLSGPDDDPLHKQPRFWASMMEAANC
PPDYVPPEIFHFHTRADVQLYGMIYKPHTLQPGRKHPTVLFVYGGPQVQL
VNNSFKGIKYLRLNTLASLGYAVVVIDGRGSCQRGLHFEGALKNQMGQVE
IEDQVEGLQYVAEKYGFIDLSRVAIHGWSYGGFLSLMGLIHKPQVFKVAI
AGAPVTVWMAYDTGYTERYMDVPENNKQGYEAGSVALHVEKLPNEPNRLL
ILHGFLDENVHFFHTNFLVSQLIRAGKPYQLQIYPNERHSIRCRESGEHY
EVTLLHFLQEHL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MCSGVSPVEQVAAGDMDDTAARFCVQKHSWDGLRSIIHGSRKSSGLIVSK
APHDFQFVQKPDESGPHSHRLYYLGMPYGSRENSLLYSEIPKKVRKEALL
LLSWKQMLDHFQATPHHGVYSREEELLRERKRLGVFGITSYDFHSESGLF
LFQASNSLFHCRDGGKNGFMVSPMKPLEIKTQCSGPRMDPKICPADPAFF
SFINNSDLWVANIETGEERRLTFCHQGSAGVLDNPKSAGVATFVIQEEFD
RFTGCWWCPTASWEGSEGLKTLRILYEEVDESEVEVIHVPSPALEERKTD
SYRYPRTGSKNPKIALKLAELQTDHQGKIVSSCEKELVQPFSSLFPKVEY
IARAGWTRDGKYAWAMFLYRPQQRLQLVLLPPALFIPAVESEAQRQAAAR
AVPKNVQPFVIYEEVTNVWINVHDIFHPFPQAEGQQDFCFLRANECKTGF
CHLYRVTVELKTKDYDWTEPLSPTEDEFKCPIKEEVALTSGEWEVLSRHG
SKIWVNEQTKLVYFQGTKDTPLEHHLYVVSYESAGEIVRLTTLGFSHSCS
MSQSFDMFVSHYSSVSTPPCVHVYKLSGPDDDPLHKQPRFWASMMEAANC
PPDYVPPEIFHFHTRADVQLYGMIYKPHTLQPGRKHPTVLFVYGGPQVQL
VNNSFKGIKYLRLNTLASLGYAVVVIDGRGSCQRGLHFEGALKNQMGQVE
IEDQVEGLQYVAEKYGFIDLSRVAIHGWSYGGFLSLMGLIHKPQVFKVAI
AGAPVTVWMAYDTGYTERYMDVPENNKQGYEAGSVALHVEKLPNEPNRLL
ILHGFLDENVHFFHTNFLVSQLIRAGKPYQLQIYPNERHSIRCRESGEHY
EVTLLHFLQEHL

no DNA




References
3 more
    Title: DPP9 enzymatic activity in hematopoietic cells is dispensable for mouse hematopoiesis
    Kim M, von Muenchow L, Le Meur T, Kueng B, Gapp B, Weber D, Dietrich W, Kovarik J, Rolink AG, Ksiazek I
    Ref: Immunol Lett, 198:60, 2018 : PubMed

            

    Title: Cloning and characterization of dipeptidyl peptidase 10, a new member of an emerging subgroup of serine proteases
    Qi SY, Riviere PJ, Trojnar J, Junien JL, Akinsanya KO
    Ref: Biochemical Journal, 373:179, 2003 : PubMed

            

    Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
    Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R and Hayashizaki Y <127 more author(s)>
    Ref: Nature, 420:563, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer