mouse-f172a

 
Mus musculus (Mouse). Cotranscriptional regulator FAM172A

Relationship
Block X
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 10 more: AK165273, AK166285, AC167171
>3 UniProt links 5 more: Q3TNH5, A0A286YCN2, A0A286YD37
>3 UniProtTrembl links 6 more: Q3TNH5, Q3TLW0, A0A286YCN2
>3 Interpro links 6 more: Q3TNH5, Q3TLW0, A0A286YCN2
>3 Prodom links 6 more: Q3TNH5, Q3TLW0, A0A286YCN2
>3 Pfam links 6 more: Q3TNH5, Q3TLW0, A0A286YCN2
>3 PIRSF links 6 more: Q3TNH5, Q3TLW0, A0A286YCN2
>3 SUPERFAM links 6 more: Q3TNH5, Q3TLW0, A0A286YCN2
>3 QuickSwissBlast links 6 more: Q3TNH5, Q3TLW0, A0A286YCN2
 
Sequence
Graphical view for this peptide sequence: mouse-f172a
Colored MSA for Arb2_FAM172A (raw)
MSISLSSLIFLPIWINMAQMQQGGSNETEQTAALKDLLSRIDLDELMKKD
EPPFDFPDTLEGFEYAFNEKGQLRHIKTGEPFVFNYREDLHRWNQKRYEA
LGEIITRYVYELLESDCNLKKISIPVDATESEPKSFIFMSEDALTNPQKL
MVLIHGSGVVRAGQWARRLIINEDLDSGTQIPFIKRAMDEGYGVIVLNPN
ENYIEVEKQKMHKQSSSSDGTDEPAGKRERRDKVSKETKKRRDFYEKYRN
PQKEKEMMQLFIRENGSPEEHAVYVWDHFIAQAAAENVFFVAHSYGGLAF
VELMIQREADVKSKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSS
SEPLDTSVESMLPDCPRVSAGTDRHELTSWKSFPSIFKFFAEASEAKSSS
QKPALTRRSHRIKHEEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSISLSSLIFLPIWINMAQMQQGGSNETEQTAALKDLLSRIDLDELMKKD
EPPFDFPDTLEGFEYAFNEKGQLRHIKTGEPFVFNYREDLHRWNQKRYEA
LGEIITRYVYELLESDCNLKKISIPVDATESEPKSFIFMSEDALTNPQKL
MVLIHGSGVVRAGQWARRLIINEDLDSGTQIPFIKRAMDEGYGVIVLNPN
ENYIEVEKQKMHKQSSSSDGTDEPAGKRERRDKVSKETKKRRDFYEKYRN
PQKEKEMMQLFIRENGSPEEHAVYVWDHFIAQAAAENVFFVAHSYGGLAF
VELMIQREADVKSKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSS
SEPLDTSVESMLPDCPRVSAGTDRHELTSWKSFPSIFKFFAEASEAKSSS
QKPALTRRSHRIKHEEL

no DNA




References
2 more
    Title: A tissue-specific atlas of mouse protein phosphorylation and expression
    Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP
    Ref: Cell, 143:1174, 2010 : PubMed

            

    Title: Lineage-specific biology revealed by a finished genome assembly of the mouse
    Church DM, Goodstadt L, Hillier LW, Zody MC, Goldstein S, She X, Bult CJ, Agarwala R, Cherry JL and Ponting CP <21 more author(s)>
    Ref: PLoS Biol, 7:e1000112, 2009 : PubMed

            

    Title: The transcriptional landscape of the mammalian genome
    Carninci P, Kasukawa T, Katayama S, Gough J, Frith MC, Maeda N, Oyama R, Ravasi T, Lenhard B and Hayashizaki Y <184 more author(s)>
    Ref: Science, 309:1559, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer