mouse-hslip

 
Mus musculus mRNA for hormone sensitive lipase

Comment
Q9CTW2 Kawai differs only 1aa from P54310 (from Uniprot) Lipase with broad substrate specificity, catalyzing the hydrolysis of triacylglycerols (TAGs), diacylglycerols (DAGs), monoacylglycerols (MAGs), cholesteryl esters and retinyl esters. Shows a preferential hydrolysis of DAGs over TAGs and MAGs and of the fatty acid (FA) esters at the sn-1 and sn-2 positions of the glycerol backbone in TAGs (By similarity). Preferentially hydrolyzes FA esters at the sn-3 position of the glycerol backbone in DAGs. Catalyzes the hydrolysis of 2-arachidonoylglycerol, an endocannabinoid and of 2-acetyl monoalkylglycerol ether, the penultimate precursor of the pathway for de novo synthesis of platelet-activating factor. In adipose tissue and heart, it primarily hydrolyzes stored triglycerides to free fatty acids, while in steroidogenic tissues, it principally converts cholesteryl esters to free cholesterol for steroid hormone production.


Relationship
Block H
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic


Inhibitor: ABP-C6 , NBD-TG , NBD-HE-HP ,
>3 Genbank links 3 more: U08188, AK019846, BC021642
2 UniProt : P54310, Q9CTW2
1 Ncbi-nid : 677884
2 UniProtTrembl : Q9CTW2, P54310
2 Interpro : Q9CTW2, P54310
2 Prodom : Q9CTW2, P54310
2 Pfam : Q9CTW2, P54310
2 PIRSF : Q9CTW2, P54310
2 SUPERFAM : Q9CTW2, P54310
2 QuickSwissBlast : Q9CTW2, P54310
1 MGD : 96790
2 ENSEMBL : P54310, ENSMUSG00000003123
 
Sequence
Graphical view for this peptide sequence: mouse-hslip
Colored MSA for Hormone-sensitive_lipase_like (raw)
MDLRTMTQSLVTLAEDNMAFFSSQGPGETARRLSNVFAGVREQALGLEPT
LGQLLGVAHHFDLDTETPANGYRSLVHTARCCLAHLLHKSRYVASNRKSI
FFRASHNLAELEAYLAALTQLRAMAYYAQRLLTINRPGVLFFEGDEGLTA
DFLQEYVTLHKGCFYGRCLGFQFTPAIRPFLQTLSIGLVSFGEHYKRNET
GLSVTASSLFTGGRFAIDPELRGAEFERIIQNLDVHFWKAFWNITEIEVL
SSLANMASTTVRVSRLLSLPPEAFEMPLTSDPRLTVTISPPLAHTGPAPV
LARLISYDLREGQDSKVLNSLAKSEGPRLDVRPRPHQAPRSRALVVHIHG
GGFVAQTSKSHEPYLKNWAQELGVPIFSIDYSLAPEAPFPRALEECFFAY
CWAVKHCDLLGSTGERICLAGDSAGGNLCITVSLRAAAYGVRVPDGIMAA
YPVTTLQSSASPSRLLSLMDPLLPLSVLSKCVSAYSGTEAEDHFDSDQKA
LGVMGLVQRDTSLFLRDLRLGASSWLNSFPELSGRKPQKTTSPTAESVRP
TESMRRSVSEAALAQPEGLLGTDTLKKLTIKDLSNSEPSDSPEMSQSMET
LGPSTPSDVNFFLRPGNSQEEAEAKDEVRPMDGVPRVRAAFPEGFHPRRS
SQGVLHMPLYTSPIVKNPFMSPLLAPDSMLKTLPPVHLVACALDPMLDDS
VMFARRLRDLGQPVTLKVVEDLPHGFLSLAALCRETRQATEFCVQRIRLI
LTPPAAPLN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDLRTMTQSLVTLAEDNMAFFSSQGPGETARRLSNVFAGVREQALGLEPT
LGQLLGVAHHFDLDTETPANGYRSLVHTARCCLAHLLHKSRYVASNRKSI
FFRASHNLAELEAYLAALTQLRAMAYYAQRLLTINRPGVLFFEGDEGLTA
DFLQEYVTLHKGCFYGRCLGFQFTPAIRPFLQTLSIGLVSFGEHYKRNET
GLSVTASSLFTGGRFAIDPELRGAEFERIIQNLDVHFWKAFWNITEIEVL
SSLANMASTTVRVSRLLSLPPEAFEMPLTSDPRLTVTISPPLAHTGPAPV
LARLISYDLREGQDSKVLNSLAKSEGPRLDVRPRPHQAPRSRALVVHIHG
GGFVAQTSKSHEPYLKNWAQELGVPIFSIDYSLAPEAPFPRALEECFFAY
CWAVKHCDLLGSTGERICLAGDSAGGNLCITVSLRAAAYGVRVPDGIMAA
YPVTTLQSSASPSRLLSLMDPLLPLSVLSKCVSAYSGTEAEDHFDSDQKA
LGVMGLVQRDTSLFLRDLRLGASSWLNSFPELSGRKPQKTTSPTAESVRP
TESMRRSVSEAALAQPEGLLGTDTLKKLTIKDLSNSEPSDSPEMSQSMET
LGPSTPSDVNFFLRPGNSQEEAEAKDEVRPMDGVPRVRAAFPEGFHPRRS
SQGVLHMPLYTSPIVKNPFMSPLLAPDSMLKTLPPVHLVACALDPMLDDS
VMFARRLRDLGQPVTLKVVEDLPHGFLSLAALCRETRQATEFCVQRIRLI
LTPPAAPLN

Graphical view for this nucleotide DNA sequence (3249 bp): mouse-hslip



References
26 more
    Title: Cholesteryl ester accumulation and accelerated cholesterol absorption in intestine-specific hormone sensitive lipase-null mice
    Obrowsky S, Chandak PG, Patankar JV, Pfeifer T, Povoden S, Schreiber R, Haemmerle G, Levak-Frank S, Kratky D
    Ref: Biochimica & Biophysica Acta, 1821:1406, 2012 : PubMed

            

    Title: Hormone-sensitive lipase knockout mice have increased hepatic insulin sensitivity and are protected from short-term diet-induced insulin resistance in skeletal muscle and heart
    Park SY, Kim HJ, Wang S, Higashimori T, Dong J, Kim YJ, Cline G, Li H, Prentki M and Kim JK <2 more author(s)>
    Ref: American Journal of Physiology Endocrinol Metab, 289:E30, 2005 : PubMed

            

    Title: Isolation and characterization of the gene for mouse hormone-sensitive lipase
    Li Z, Sumida M, Birchbauer A, Schotz MC, Reue K
    Ref: Genomics, 24:259, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer