Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-lcat

Mus musculus mRNA for phosphatidylcholine-sterol acyltransferase ( lecithin: cholesterol acyltransferase)

Relationship
Family|PC-sterol_acyltransferase
Block| L
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : J05154, BC028861, AF236367
2 UniProt : P16301, Q791M3
1 Ncbi-nid : 198759
3 UniProt : Q791M3, P16301, Q9CW47
3 Interpro : Q791M3, P16301, Q9CW47
3 Prodom : Q791M3, P16301, Q9CW47
3 Pfam : Q791M3, P16301, Q9CW47
3 PIRSF : Q791M3, P16301, Q9CW47
3 SUPERFAM : Q791M3, P16301, Q9CW47
1 MGD : 96755
2 ENSEMBL : P16301, ENSMUSG00000035237
Sequence
Graphical view for this peptide sequence: mouse-lcat
Colored MSA for PC-sterol_acyltransferase (raw)
MGLPGSPWQRVLLLLGLLLPPATPFWLLNVLFPPHTTPKAELSNHTRPVI
LVPGCLGNRLEAKLDKPDVVNWMCYRKTEDFFTIWLDFNLFLPLGVDCWI
DNTRIVYNHSSGRVSNAPGVQIRVPGFGKTESVEYVDDNKLAGYLHTLVQ
NLVNNGYVRDETVRAAPYDWRLAPHQQDEYYKKLAGLVEEMYAAYGKPVF
LIGHSLGCLHVLHFLLRQPQSWKDHFIDGFISLGAPWGGSIKAMRILASG
DNQGIPILSNIKLKEEQRITTTSPWMLPAPHVWPEDHVFISTPNFNYTVQ
DFERFFTDLHFEEGWHMFLQSRDLLERLPAPGVEVYCLYGVGRPTPHTYI
YDHNFPYKDPVAALYEDGDDTVATRSTELCGQWQGRQSQPVHLLPMNETD
HLNMVFSNKTMEHINAILLGAYRTPKSPAASPSPPPPE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGLPGSPWQRVLLLLGLLLPPATPFWLLNVLFPPHTTPKAELSNHTRPVI
LVPGCLGNRLEAKLDKPDVVNWMCYRKTEDFFTIWLDFNLFLPLGVDCWI
DNTRIVYNHSSGRVSNAPGVQIRVPGFGKTESVEYVDDNKLAGYLHTLVQ
NLVNNGYVRDETVRAAPYDWRLAPHQQDEYYKKLAGLVEEMYAAYGKPVF
LIGHSLGCLHVLHFLLRQPQSWKDHFIDGFISLGAPWGGSIKAMRILASG
DNQGIPILSNIKLKEEQRITTTSPWMLPAPHVWPEDHVFISTPNFNYTVQ
DFERFFTDLHFEEGWHMFLQSRDLLERLPAPGVEVYCLYGVGRPTPHTYI
YDHNFPYKDPVAALYEDGDDTVATRSTELCGQWQGRQSQPVHLLPMNETD
HLNMVFSNKTMEHINAILLGAYRTPKSPAASPSPPPPE


References
1 more
    Title: Lipoprotein X Causes Renal Disease in LCAT Deficiency
    Ossoli A, Neufeld EB, Thacker SG, Vaisman B, Pryor M, Freeman LA, Brantner CA, Baranova I, Francone NO and Remaley AT <7 more author(s)>
    Ref: PLoS ONE, 11:e0150083, 2016 : PubMed

            

    Title: Functional annotation of a full-length mouse cDNA collection
    Kawai J, Shinagawa A, Shibata K, Yoshino M, Itoh M, Ishii Y, Arakawa T, Hara A, Fukunishi Y and Hayashizaki Y <86 more author(s)>
    Ref: Nature, 409:685, 2001 : PubMed

            

    Title: Tissue-specific expression, developmental regulation, and chromosomal mapping of the lecithin: cholesterol acyltransferase gene. Evidence for expression in brain and testes as well as liver
    Warden CH, Langner CA, Gordon JI, Taylor BA, McLean JW, Lusis AJ
    Ref: Journal of Biological Chemistry, 264:21573, 1989 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer