Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-lypl1

Mus musculus (Mouse) lysophospholipase-like protein 1 (EC 3.1.2.-) 26.3 kda protein

Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
2 inhibitors: ABP-C6, NBD-HE-HP
2 Genbank : BC027340, AK148533
1 UniProt : Q3UFF7
1 UniProt : Q3UFF7
1 Interpro : Q3UFF7
1 Prodom : Q3UFF7
1 Pfam : Q3UFF7
1 PIRSF : Q3UFF7
1 SUPERFAM : Q3UFF7
1 ENSEMBL : ENSMUSG00000039246
Sequence
Graphical view for this peptide sequence: mouse-lypl1
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MAAVPSAVHLPRCVVSPTGRHSASLIFLHGSGHSGQGQREWIKHVLNQDL
TFQHIKITYPTAPSRPYTPLKGGLSNVWFDRFKISMDCPEHLESIDSMCQ
VLSGLIDEEVKTGIQKSRILIGGFSMGGCMAMHLAYRSHPDVAGVFVLSG
FLNKASVVYQDLQQGGRMLPELFQCHGSADNLVLHAWGKETNSKLKSLGV
STTFHSLPNLNHELNKTELEKLKSWILTRLPGETDGQSE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAAVPSAVHLPRCVVSPTGRHSASLIFLHGSGHSGQGQREWIKHVLNQDL
TFQHIKITYPTAPSRPYTPLKGGLSNVWFDRFKISMDCPEHLESIDSMCQ
VLSGLIDEEVKTGIQKSRILIGGFSMGGCMAMHLAYRSHPDVAGVFVLSG
FLNKASVVYQDLQQGGRMLPELFQCHGSADNLVLHAWGKETNSKLKSLGV
STTFHSLPNLNHELNKTELEKLKSWILTRLPGETDGQSE


References
    Title: Gene-by-Sex Interactions in Mitochondrial Functions and Cardio-Metabolic Traits
    Norheim F, Hasin-Brumshtein Y, Vergnes L, Chella Krishnan K, Pan C, Seldin MM, Hui ST, Mehrabian M, Zhou Z and Lusis AJ <6 more author(s)>
    Ref: Cell Metab, 29:932, 2019 : PubMed

            

    Title: Lyplal1 is dispensable for normal fat deposition in mice
    Watson RA, Gates AS, Wynn EH, Calvert FE, Girousse A, Lelliott CJ, Barroso I
    Ref: Dis Model Mech, 10:1481, 2017 : PubMed

            

    Title: Obesity associated Lyplal1 gene is regulated in diet induced obesity but not required for adipocyte differentiation
    Lei X, Callaway M, Zhou H, Yang Y, Chen W
    Ref: Mol Cell Endocrinol, 411:207, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer