mouse-lypla1

 
Mus musculus lysophospholipase 1 (Lypla1)(lysopla I), mRNA

Relationship
Block X
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic


Inhibitor: ML211 , ABP-C6 , NBD-HE-HP ,
>3 Genbank links 7 more: NM_008866, U89352, AK002674
2 UniProt : P97823, Q4FK51
1 Ncbi-nid : 6678759
1 Ncbi-pid : 6678760
3 UniProtTrembl : P97823, Q8BWM6, Q4FK51
3 Interpro : P97823, Q8BWM6, Q4FK51
3 Prodom : P97823, Q8BWM6, Q4FK51
3 Pfam : P97823, Q8BWM6, Q4FK51
3 PIRSF : P97823, Q8BWM6, Q4FK51
3 SUPERFAM : P97823, Q8BWM6, Q4FK51
3 QuickSwissBlast : P97823, Q8BWM6, Q4FK51
1 MGD : 1344588
2 ENSEMBL : P97823, ENSMUSG00000025903
 
Sequence
Graphical view for this peptide sequence: mouse-lypla1
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIK
YICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALI
DQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRA
SFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTF
KIYEGMMHSSCQQEMMDVKHFIDKLLPPID
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIK
YICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALI
DQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRA
SFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTF
KIYEGMMHSSCQQEMMDVKHFIDKLLPPID

Graphical view for this nucleotide DNA sequence (721 bp): mouse-lypla1



References
1 more
    Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
    Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R and Hayashizaki Y <127 more author(s)>
    Ref: Nature, 420:563, 2002 : PubMed

            

    Title: Functional annotation of a full-length mouse cDNA collection
    Kawai J, Shinagawa A, Shibata K, Yoshino M, Itoh M, Ishii Y, Arakawa T, Hara A, Fukunishi Y and Hayashizaki Y <86 more author(s)>
    Ref: Nature, 409:685, 2001 : PubMed

            

    Title: Cloning, expression, and catalytic mechanism of murine lysophospholipase I
    Wang A, Deems RA, Dennis EA
    Ref: Journal of Biological Chemistry, 272:12723, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer