mouse-lypla2

 
Mus musculus lysophospholipase 2 (Lypla2), mRNA

Relationship
Block X
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic


Inhibitor: ABP-C6 , NBD-HE-HP ,
>3 Genbank links 5 more: NM_011942, AB009653, AK003689
1 UniProt : Q9WTL7
1 Ncbi-nid : 7242155
1 Ncbi-pid : 7242156
1 UniProtTrembl : Q9WTL7
1 Interpro : Q9WTL7
1 Prodom : Q9WTL7
1 Pfam : Q9WTL7
1 PIRSF : Q9WTL7
1 SUPERFAM : Q9WTL7
1 QuickSwissBlast : Q9WTL7
1 MGD : 1347000
2 ENSEMBL : Q9WTL7, ENSMUSG00000028670
 
Sequence
Graphical view for this peptide sequence: mouse-lypla2
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP
HVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIK
ALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLP
LHRNFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRTVVTPARV
QFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP
HVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIK
ALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLP
LHRNFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRTVVTPARV
QFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV

Graphical view for this nucleotide DNA sequence (1639 bp): mouse-lypla2



References
    Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
    Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R and Hayashizaki Y <127 more author(s)>
    Ref: Nature, 420:563, 2002 : PubMed

            

    Title: Functional annotation of a full-length mouse cDNA collection
    Kawai J, Shinagawa A, Shibata K, Yoshino M, Itoh M, Ishii Y, Arakawa T, Hara A, Fukunishi Y and Hayashizaki Y <86 more author(s)>
    Ref: Nature, 409:685, 2001 : PubMed

            

    Title: Sequence, expression in Escherichia coli, and characterization of lysophospholipase II
    Toyoda T, Sugimoto H, Yamashita S
    Ref: Biochimica & Biophysica Acta, 1437:182, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer