Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-ndr2

Mus musculus (Mouse) ndrg2 protein (ndr2 protein)

Relationship
Family|Ndr_family
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
2QMQ: Crystal structure of N-myc downstream regulated 2 (15277975) from Mus musculus at 1.70 A resolution
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: mouse-ndr2
Colored MSA for Ndr_family (raw)
MAELQEVQITEEKPLLPGQTPETAKEAELAARILLDQGQTHSVETPYGSV
TFTVYGTPKPKRPAIFTYHDVGLNYKSCFQPLFRFGDMQEIIQNFVRVHV
DAPGMEEGAPVFPLGYQYPSLDQLADMIPCILQYLNFSTIIGVGVGAGAY
ILSRYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPDMILGH
LFSQEELSGNSELIQKYRGIIQHAPNLENIELYWNSYNNRRDLNFERGGE
TTLKCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQP
GKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASIDGSRSRSRTLS
QSSESGTLPSGPPGHTMEVSC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAELQEVQITEEKPLLPGQTPETAKEAELAARILLDQGQTHSVETPYGSV
TFTVYGTPKPKRPAIFTYHDVGLNYKSCFQPLFRFGDMQEIIQNFVRVHV
DAPGMEEGAPVFPLGYQYPSLDQLADMIPCILQYLNFSTIIGVGVGAGAY
ILSRYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPDMILGH
LFSQEELSGNSELIQKYRGIIQHAPNLENIELYWNSYNNRRDLNFERGGE
TTLKCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQP
GKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASIDGSRSRSRTLS
QSSESGTLPSGPPGHTMEVSC


References
1 more
    Title: Impaired differentiation of macrophage lineage cells attenuates bone remodeling and inflammatory angiogenesis in Ndrg1 deficient mice
    Watari K, Shibata T, Nabeshima H, Shinoda A, Fukunaga Y, Kawahara A, Karasuyama K, Fukushi J, Iwamoto Y and Ono M <1 more author(s)>
    Ref: Sci Rep, 6:19470, 2016 : PubMed

            

    Title: Prediction of the coding sequences of mouse homologues of KIAA gene: IV. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries
    Okazaki N, R FK, Ohara R, Inamoto S, Koseki H, Hiraoka S, Saga Y, Seino S, Nishimura M and Koga H <5 more author(s)>
    Ref: DNA Research, 11:205, 2004 : PubMed

            

    Title: Identification of new genes ndr2 and ndr3 which are related to Ndr1/RTP/Drg1 but show distinct tissue specificity and response to N-myc
    Okuda T, Kondoh H
    Ref: Biochemical & Biophysical Research Communications, 266:208, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer