Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: musdo-EST23aes07

Musca domestica carboxylesterase MdaE7 (MdaE7) MdalphaE7 (EC 3.1.1.1)

Comment
Q86D38 AY230002 Scott_2003 AlphaE7-v2 allele AY237158 AlphaE7-v3 allele; AY244356 Q86D38 strain YPER no difference;Q86D39 AY244355 Q86D38 AY244354 strain NG98; Q86MJ8 AY237158 strain LPR; strain Q86MJ9 AY230002 aabys


Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Musca domestica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Calyptratae: N E > Muscoidea: N E > Muscidae: N E > Muscinae: N E > Muscini: N E > Musca [genus]: N E > Musca [subgenus]: N E > Musca domestica: N E


Molecular evidence
Database
13 mutations: Table (e.g. : A365V, D273E, G137D ... more)
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: musdo-EST23aes07
Colored MSA for Carb_B_Arthropoda (raw)
MNFKVSQMERLSWKLKCMVNKYTNYRLSTNETQIIDTEYGQIKGVKRMTV
YDDSYYSFESIPYAKPPVGELRFKAPQRPVPWEGVRDCCGPANRSVQTDF
ISGKPTGSEDCLYLNVYTNDLNPDKKRPVMVFIHGGGFIFGEANRNWFGP
DYFMKKPVVLVTVQYRLGVLGFLSLKSENLNVPGNAGLKDQVMALRWVKS
NIANFGGDVDNITVFGESAGGASTHYMMITEQTRGLFHRGIMMSGNSMCS
WASTECQSRALTMAKRVGYKGEDNEKDILEFLMKANPYDLIKEEPQVLTP
EEMQNKVMFPFGPTVEPYQTADCVVPKPIREMVKSAWGNSIPTLIGNTSY
EGLLFKSIAKQYPEVVKELESCVNYVPWELADSERSAPETLERAAIVKKA
HVDGETPTLDNFMELCSYFYFLFPMHRFLQLRFNHTAGTPIYLYRFDFDS
EEIINPYRIMRFGRGVKGVSHADELTYLFWNILSKRLPKESREYKTIERM
VGIWTEFATTGKPYSNDIAGMENLTWDPIKKSDDVYKCLNIGDELKVMDL
PEMDKIKQWASIFDKKKELF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNFKVSQMERLSWKLKCMVNKYTNYRLSTNETQIIDTEYGQIKGVKRMTV
YDDSYYSFESIPYAKPPVGELRFKAPQRPVPWEGVRDCCGPANRSVQTDF
ISGKPTGSEDCLYLNVYTNDLNPDKKRPVMVFIHGGGFIFGEANRNWFGP
DYFMKKPVVLVTVQYRLGVLGFLSLKSENLNVPGNAGLKDQVMALRWVKS
NIANFGGDVDNITVFGESAGGASTHYMMITEQTRGLFHRGIMMSGNSMCS
WASTECQSRALTMAKRVGYKGEDNEKDILEFLMKANPYDLIKEEPQVLTP
EEMQNKVMFPFGPTVEPYQTADCVVPKPIREMVKSAWGNSIPTLIGNTSY
EGLLFKSIAKQYPEVVKELESCVNYVPWELADSERSAPETLERAAIVKKA
HVDGETPTLDNFMELCSYFYFLFPMHRFLQLRFNHTAGTPIYLYRFDFDS
EEIINPYRIMRFGRGVKGVSHADELTYLFWNILSKRLPKESREYKTIERM
VGIWTEFATTGKPYSNDIAGMENLTWDPIKKSDDVYKCLNIGDELKVMDL
PEMDKIKQWASIFDKKKELF


References
7 more
    Title: Esterase-mediated spinosad resistance in house flies Musca domestica (Diptera: Muscidae)
    Zhang Y, Guo M, Ma Z, You C, Gao X, Shi X
    Ref: Ecotoxicology, 29:35, 2020 : PubMed

            

    Title: Functional Characterization of Carboxylesterases in Insecticide Resistant House Flies, Musca Domestica
    Feng X, Liu N
    Ref: J Vis Exp, 138:e58106, 2018 : PubMed

            

    Title: Multiple mutations and overexpression of the MdaE7 carboxylesterase gene associated with male-linked malathion resistance in housefly, Musca domestica (Diptera: Muscidae)
    Zhang Y, Li J, Ma Z, Shan C, Gao X
    Ref: Sci Rep, 8:224, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer