Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: muspf-m3yy03

Mustela putorius furo (European domestic ferret) (Mustela furo). Serine hydrolase like 2

Relationship
Family|SERHL
Block| X
Position in NCBI Life Tree|Mustela putorius furo
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Carnivora: N E > Caniformia: N E > Mustelidae: N E > Mustelinae: N E > Mustela: N E > Mustela putorius: N E > Mustela putorius furo: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: AEYP01076845, AEYP01076846, AEYP01076847
2 UniProt : M3YY03, G9KN44
2 UniProt : M3YY03, G9KN44
2 Interpro : M3YY03, G9KN44
2 Prodom : M3YY03, G9KN44
2 Pfam : M3YY03, G9KN44
2 PIRSF : M3YY03, G9KN44
2 SUPERFAM : M3YY03, G9KN44
Sequence
Graphical view for this peptide sequence: muspf-m3yy03
Colored MSA for SERHL (raw)
GCVPGLLSELKLAVPWGYIAAKVWGSQQAPPVLCLHGWLDNASSFDRLIP
LLPKDFCYVAMDFGGHGLSSHYSPGLPYYQENFVSEIRRVVAALKWKHFS
IVGHSFGGAVGAMFSSIFPEMVNKLILLDTWPFPLDPKGIERVPTYRRGA
IEYVLQVEASQKPRQVASPEEMLQRFMKNNSHVSEESARLLLQRGTTKVA
TGLTLNRDRRIALPVHCMDFVSREQFVNFTKQLRAHVLLIKAMQGYFNVR
REDDTNKSIITFVTDTLKSILKERYQYIEVPGSHYVHLNQPETVAGIISA
FLQSKETIPHRM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GCVPGLLSELKLAVPWGYIAAKVWGSQQAPPVLCLHGWLDNASSFDRLIP
LLPKDFCYVAMDFGGHGLSSHYSPGLPYYQENFVSEIRRVVAALKWKHFS
IVGHSFGGAVGAMFSSIFPEMVNKLILLDTWPFPLDPKGIERVPTYRRGA
IEYVLQVEASQKPRQVASPEEMLQRFMKNNSHVSEESARLLLQRGTTKVA
TGLTLNRDRRIALPVHCMDFVSREQFVNFTKQLRAHVLLIKAMQGYFNVR
REDDTNKSIITFVTDTLKSILKERYQYIEVPGSHYVHLNQPETVAGIISA
FLQSKETIPHRM


Reference
    Title: Sequencing, annotation, and characterization of the influenza ferret infectome
    Leon AJ, Banner D, Xu L, Ran L, Peng Z, Yi K, Chen C, Xu F, Huang J and Kelvin DJ <7 more author(s)>
    Ref: J Virol, 87:1957, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer