(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Terrabacteria group: NE > Actinobacteria [phylum]: NE > Actinobacteria [class]: NE > Corynebacteriales: NE > Mycobacteriaceae: NE > Mycobacterium: NE > Mycobacterium chelonae group: NE > Mycobacterium abscessus subgroup: NE > Mycobacterium abscessus: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Mycobacteroides abscessus: N, E.
Mycobacterium abscessus 5S-0817: N, E.
Mycobacterium abscessus 4S-0206: N, E.
Mycobacterium abscessus M93: N, E.
Mycobacterium abscessus M94: N, E.
Mycobacterium abscessus subsp. bolletii CCUG 48898 = JCM 15300: N, E.
Mycobacterium abscessus subsp. bolletii BD: N, E.
Mycobacterium abscessus subsp. bolletii 50594: N, E.
Mycobacterium abscessus subsp. abscessus: N, E.
Mycobacteroides abscessus subsp. abscessus: N, E.
Mycobacterium abscessus 103: N, E.
Mycobacterium abscessus ATCC 19977: N, E.
Mycobacterium abscessus 47J26: N, E.
Mycobacterium abscessus subsp. bolletii 2B-0912-R: N, E.
Mycobacterium abscessus subsp. bolletii 1513: N, E.
Mycobacterium abscessus 5S-0708: N, E.
Mycobacterium abscessus 3A-0122-R: N, E.
Mycobacterium abscessus MAB_030201_1061: N, E.
Mycobacterium abscessus 3A-0119-R: N, E.
Mycobacterium abscessus MAB_091912_2455: N, E.
Mycobacterium abscessus 5S-0304: N, E.
Mycobacterium abscessus subsp. bolletii 1S-154-0310: N, E.
Mycobacterium abscessus 3A-0810-R: N, E.
Mycobacterium abscessus subsp. bolletii CRM-0020: N, E.
Mycobacterium abscessus 4S-0116-S: N, E.
Mycobacterium abscessus MAB_082312_2258: N, E.
Mycobacterium abscessus 3A-0930-S: N, E.
Mycobacterium abscessus subsp. bolletii 2B-0107: N, E.
Mycobacterium abscessus 3A-0731: N, E.
Mycobacterium abscessus MAB_091912_2446: N, E.
Mycobacterium abscessus 4S-0303: N, E.
Mycobacterium abscessus 5S-0422: N, E.
Mycobacterium abscessus subsp. bolletii 2B-0912-S: N, E.
Mycobacterium abscessus 6G-0212: N, E.
Mycobacterium abscessus 1948: N, E.
Mycobacterium abscessus MAB_110811_2726: N, E.
Mycobacterium abscessus V06705: N, E.
Mycobacterium abscessus subsp. bolletii 1S-151-0930: N, E.
Mycobacterium abscessus 6G-0125-R: N, E.
Mycobacterium abscessus subsp. bolletii str. GO 06: N, E.
Mycobacterium abscessus subsp. bolletii 1S-152-0914: N, E.
Mycobacterium abscessus subsp. bolletii 1S-153-0915: N, E.
Mycobacterium abscessus 5S-1212: N, E.
Mycobacterium abscessus 6G-0728-R: N, E.
Mycobacterium abscessus 6G-0125-S: N, E.
Mycobacterium abscessus 5S-1215: N, E.
Mycobacterium abscessus 6G-0728-S: N, E.
Mycobacterium abscessus subsp. bolletii 2B-0307: N, E.
Mycobacterium abscessus 5S-0921: N, E.
Mycobacterium abscessus MAB_082312_2272: N, E.
Mycobacterium abscessus 6G-1108: N, E.
Mycobacterium abscessus 4S-0116-R: N, E.
Mycobacterium abscessus 5S-0421: N, E.
Mycobacterium abscessus subsp. bolletii 2B-1231: N, E.
Mycobacterium abscessus 4S-0726-RA: N, E.
Mycobacterium abscessus subsp. bolletii 2B-0626: N, E.
Mycobacterium abscessus MAB_030201_1075: N, E.
Mycobacterium abscessus 4S-0726-RB: N, E.
Mycobacterium abscessus MAB_110811_1470: N, E.
Mycobacterium abscessus 3A-0122-S: N, E.
Mycobacterium abscessus 3A-0930-R: N, E.
Mycobacterium abscessus 21: N, E.
Mycobacterium abscessus subsp. bolletii 103: N, E.
Mycobacteroides abscessus subsp. massiliense: N, E.
Mycobacteroides abscessus subsp. bolletii: N, E.
Mycobacterium chelonae 1518: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MASGSKTPTVRVTTPNGIVEGFVRGGVRRFRSIPYARPPIGLLRLRAPQP ALPWEGVRDCTEFGAAAPQRRRYRVLGPGRVQRASEDCLTVNVVTPDRPS NEPLPVMFFIYGGGYLLGSSATPLYDGAALARRGCVYVSVNYRVGALGAL DLSSLSDRDHTIDGNLFLRDVVLALQWVHDNIGTFGGDPGNVTIFGESAG AHCVETLMATPAAAGLFHRAICQSTASGMAVPADSAAMYAQKFAQILGAT TQSAAETVLRSSPAELGAALNMLIADIVTNMPGGSFAIGPCIDGHYLPRH PIEAMEHGEAHRVPLIVGHNADEAKLFTRVLKMMPLSESALEGMLARGGP GHRDRIVAAYPGYPERSARVKLAGDMNFSTAAWQMAEAHHRYAPVYFYRY DYAPGALRIAGMGATHATELLAVFDSYRGAMGTVMAGALGRRDAVRVSND VQRRWLAFARSGVPGDGWPTYGPPDRAVMVFDHATRVELDPEAARRAAWE GFSLTL
Mycobacterium abscessus is a rapidly growing environmental mycobacterium commonly found in soil and water which is often also associated with infections in humans, particularly of the lung. We report herein the draft genome sequence of M. abscessus strain 47J26.
        
Title: Draft genome sequence of Mycobacterium abscessus subsp. bolletii BD(T) Choi GE, Cho YJ, Koh WJ, Chun J, Cho SN, Shin SJ Ref: Journal of Bacteriology, 194:2756, 2012 : PubMed
Mycobacterium abscessus subsp. bolletii is an increasing cause of human pulmonary disease and infections of the skin and soft tissues. Consistent reports of human infections indicate that M. bolletii is a highly pathogenic, emerging species of rapidly growing mycobacteria (RGM). Here we report the first whole-genome sequence of M. abscessus subsp. bolletii BD(T).
Mycobacterium abscessus is a rapid-growing species of nontuberculous mycobacteria that is frequently associated with opportunistic infections in humans. We report herein the draft genome sequence of M. abscessus strain M93.
Three recently sequenced strains isolated from patients during an outbreak of Mycobacterium abscessus subsp. massiliense infections at a cystic fibrosis center in the United States were compared with 6 strains from an outbreak at a cystic fibrosis center in the United Kingdom and worldwide strains. Strains from the 2 cystic fibrosis outbreaks showed high-level relatedness with each other and major-level relatedness with strains that caused soft tissue infections during an epidemic in Brazil. We identified unique single-nucleotide polymorphisms in cystic fibrosis and soft tissue outbreak strains, separate single-nucleotide polymorphisms only in cystic fibrosis outbreak strains, and unique genomic traits for each subset of isolates. Our findings highlight the necessity of identifying M. abscessus to the subspecies level and screening all cystic fibrosis isolates for relatedness to these outbreak strains. We propose 2 diagnostic strategies that use partial sequencing of rpoB and secA1 genes and a multilocus sequence typing protocol.
Multiple isolates of Mycobacterium abscessus subsp. bolletii, collectively called BRA100, were associated with outbreaks of postsurgical skin infections across various regions of Brazil from 2003 to 2009. We announce the draft genome sequence of a newly sequenced BRA100 strain, M. abscessus subsp. bolletii CRM-0020, isolated from a patient in Rio de Janeiro, Brazil.
        
Title: Complete Genome Sequence of Mycobacterium massiliense Clinical Strain Asan 50594, Belonging to the Type II Genotype Kim BJ, Kim BR, Hong SH, Seok SH, Kook YH Ref: Genome Announc, 1:, 2013 : PubMed
We report the complete genome sequence of the Mycobacterium massiliense clinical strain Asan 50594, which was grouped into the M. massiliense type II genotype, isolated from a Korean patient. This genome sequence will serve as a valuable reference for understanding the disparity in virulence and epidemiological traits between strains belonging to the Mycobacterium abscessus complex.
Infection caused by Mycobacterium abscessus strains is a growing cause of concern in both community-acquired and health care-associated diseases, as these organisms naturally display multiple drug resistances. We report an annotated draft genome sequence of M. abscessus strain V06705 obtained from a patient in France.
        
Title: Whole-genome sequence of the emerging pathogen Mycobacterium abscessus strain 47J26 Chan J, Halachev M, Yates E, Smith G, Pallen M Ref: Journal of Bacteriology, 194:549, 2012 : PubMed
Mycobacterium abscessus is a rapidly growing environmental mycobacterium commonly found in soil and water which is often also associated with infections in humans, particularly of the lung. We report herein the draft genome sequence of M. abscessus strain 47J26.
        
Title: Draft genome sequence of Mycobacterium abscessus subsp. bolletii BD(T) Choi GE, Cho YJ, Koh WJ, Chun J, Cho SN, Shin SJ Ref: Journal of Bacteriology, 194:2756, 2012 : PubMed
Mycobacterium abscessus subsp. bolletii is an increasing cause of human pulmonary disease and infections of the skin and soft tissues. Consistent reports of human infections indicate that M. bolletii is a highly pathogenic, emerging species of rapidly growing mycobacteria (RGM). Here we report the first whole-genome sequence of M. abscessus subsp. bolletii BD(T).
Mycobacterium abscessus is a rapid-growing species of nontuberculous mycobacteria that is frequently associated with opportunistic infections in humans. We report herein the draft genome sequence of M. abscessus strain M93.
Mycobacterium massiliense is a rapidly growing bacterium associated with opportunistic infections. The genome of a representative isolate (strain GO 06) recovered from wound samples from patients who underwent arthroscopic or laparoscopic surgery was sequenced. To the best of our knowledge, this is the first announcement of the complete genome sequence of an M. massiliense strain.
Mycobacterium massiliense (Mycobacterium abscessus group) is an emerging pathogen causing pulmonary disease and skin and soft tissue infections. We report the genome sequence of the type strain CCUG 48898.