(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Terrabacteria group: NE > Actinobacteria [phylum]: NE > Actinobacteria [class]: NE > Corynebacteriales: NE > Mycobacteriaceae: NE > Mycobacterium: NE > Mycobacterium chelonae group: NE > Mycobacterium abscessus subgroup: NE > Mycobacterium abscessus: NE > Mycobacterium abscessus subsp. massiliense: NE > Mycobacterium abscessus subsp. massiliense CCUG 48898 = JCM 15300: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Mycobacterium abscessus 47J26: N, E.
Mycobacterium abscessus ATCC 19977: N, E.
Mycobacterium abscessus M94: N, E.
Mycobacterium abscessus M93: N, E.
Mycobacterium abscessus subsp. bolletii BD: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MLVLSAASVVGLICAVPRASADPCSDVDVSFARGRKEPVGLGRVGDEFVD SLTPRVQATGATMNVYPVNYDAGIFSAGGGANDLSNHLQSVAASCPRTKL VIGGYSMGAEVIDTIIGVPNVGIGFNRPLPPTVGDRIVAIATFGNATHRT GGPLSGIAGVFGSRAIDLCNQGDPICMAGPNNSWDAHTSYERTGLPAEAA AFVASKLNRHGESEAE
References
Title: Whole-genome sequence of the emerging pathogen Mycobacterium abscessus strain 47J26 Chan J, Halachev M, Yates E, Smith G, Pallen M Ref: Journal of Bacteriology, 194:549, 2012 : PubMed
Mycobacterium abscessus is a rapidly growing environmental mycobacterium commonly found in soil and water which is often also associated with infections in humans, particularly of the lung. We report herein the draft genome sequence of M. abscessus strain 47J26.
Title: Draft genome sequence of Mycobacterium abscessus subsp. bolletii BD(T) Choi GE, Cho YJ, Koh WJ, Chun J, Cho SN, Shin SJ Ref: Journal of Bacteriology, 194:2756, 2012 : PubMed
Mycobacterium abscessus subsp. bolletii is an increasing cause of human pulmonary disease and infections of the skin and soft tissues. Consistent reports of human infections indicate that M. bolletii is a highly pathogenic, emerging species of rapidly growing mycobacteria (RGM). Here we report the first whole-genome sequence of M. abscessus subsp. bolletii BD(T).
Mycobacterium abscessus is a rapid-growing species of nontuberculous mycobacteria that is frequently associated with opportunistic infections in humans. We report herein the draft genome sequence of M. abscessus strain M93.
