Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mycab-h0igs7

Mycobacterium abscessus Serine esterase cutinase family

Comment
Other strains: Mycobacterium abscessus (subsp. bolletii (CCUG 48898 = JCM 15300; BD); 47J26; M94; M93; ATCC 19977 / DSM 44196


Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Mycobacterium abscessus subsp. bolletii CCUG 48898 = JCM 15300
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium chelonae group: N E > Mycobacterium abscessus subgroup: N E > Mycobacterium abscessus: N E > Mycobacterium abscessus subsp. massiliense: N E > Mycobacterium abscessus subsp. massiliense CCUG 48898 = JCM 15300: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: mycab-h0igs7
Colored MSA for Cutinase (raw)
MRYPACAVTAFLTLFGGYGMQSPPAAQAASCTDIDLAFARGTNEPAGLGD
VGKSFTDAVQKQLKGAKGMSISTYGVDYPASIDFIQAGKGSDDLSKHIQK
TAADCPKMKFVVGGYAQGAAVVDVLLGNTPPGTYTFTNPLPAGLEDRIVA
IVLFGDPKNIRPPGVDANLAIRDELLHKVIDVCNPGDFFCDPQGGDIISH
TTYAKDKLTDGAADTVVQRLVALLGHRCKGADGQSTDSATTCSPSA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRYPACAVTAFLTLFGGYGMQSPPAAQAASCTDIDLAFARGTNEPAGLGD
VGKSFTDAVQKQLKGAKGMSISTYGVDYPASIDFIQAGKGSDDLSKHIQK
TAADCPKMKFVVGGYAQGAAVVDVLLGNTPPGTYTFTNPLPAGLEDRIVA
IVLFGDPKNIRPPGVDANLAIRDELLHKVIDVCNPGDFFCDPQGGDIISH
TTYAKDKLTDGAADTVVQRLVALLGHRCKGADGQSTDSATTCSPSA


References
    Title: Whole-genome sequence of the emerging pathogen Mycobacterium abscessus strain 47J26
    Chan J, Halachev M, Yates E, Smith G, Pallen M
    Ref: Journal of Bacteriology, 194:549, 2012 : PubMed

            

    Title: Draft genome sequence of Mycobacterium abscessus subsp. bolletii BD(T)
    Choi GE, Cho YJ, Koh WJ, Chun J, Cho SN, Shin SJ
    Ref: Journal of Bacteriology, 194:2756, 2012 : PubMed

            

    Title: Genome sequence of the Mycobacterium abscessus strain M93
    Choo SW, Wong YL, Yusoff AM, Leong ML, Wong GJ, Ong CS, Ng KP, Ngeow YF
    Ref: Journal of Bacteriology, 194:3278, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer