Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mycab-r4v1a9

Mycobacterium abscessus, Mycobacterium chelonae,1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase

Comment
Other strains: Mycobacterium abscessus (5S-0708; 5S-0304; 5S-0421; 5S-0422; 5S-1215; 5S-0921; 5S-0817; 21; 3A-0731; 3A-0119-R; 4S-0726-RB; 6G-0728-S; 6G-1108; 6G-0125-R; 4S-0726-RA; M93; M94; 3A-0930-S; 3A-0930-R; 4S-0206; 6G-0728-R; 6G-0212; 3A-0122-S; 4S-0303; 3A-0122-R; 6G-0125-S; 1948; MAB_030201_1061; MAB_030201_1075; MAB_110811_1470; MAB_110811_2726; V06705; 3A-0810-R; 4S-0116-S; 4S-0116-R; MAB_091912_2455; MAB_082312_2272; MAB_091912_2446; MAB_082312_2258 subsp. bolletii; 2B-0912-S; 2B-0626; 1S-154-0310; 47J26; subsp. bolletii (50594; CCUG 48898 = JCM 15300; 2B-1231; 1S-153-0915; 2B-0307; 2B-0912-R; 1S-152-0914; 1S-151-0930); ATCC 19977 / DSM 44196; 103; BD; 1513; CRM-0020; 2B-0107)); Mycobacterium chelonae 1518


Relationship
Family|HOD-cofactorfree-dioxygenase
Block| X
Position in NCBI Life Tree|Mycobacterium abscessus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium chelonae group: N E > Mycobacterium abscessus subgroup: N E > Mycobacterium abscessus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: mycab-r4v1a9
Colored MSA for HOD-cofactorfree-dioxygenase (raw)
MYTISINGTQLTFDDQGLDNGPAILLLTGWGHDHRAYDEILPYLVPHHRV
IRMDWRGHGLDRTPVADFGPAEQFSDVVGLLNALSVRSFVPVAHAHAGWT
ALELADRLGTTRVPAVMLVDLIVTAAPPEFLQGIRAFRDPMRWQSSRLEF
LDAWLAGSDNEAVNRHIRSEMGGFGFDVWARAGRVIEDAYVTWGSPMSRM
EKMAEPPHVHHIFCTRERTGYDDLHDEFQRRNPWFSYRRLNGATHFPQLE
LPARVAEEVLGLLKAAGGNH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MYTISINGTQLTFDDQGLDNGPAILLLTGWGHDHRAYDEILPYLVPHHRV
IRMDWRGHGLDRTPVADFGPAEQFSDVVGLLNALSVRSFVPVAHAHAGWT
ALELADRLGTTRVPAVMLVDLIVTAAPPEFLQGIRAFRDPMRWQSSRLEF
LDAWLAGSDNEAVNRHIRSEMGGFGFDVWARAGRVIEDAYVTWGSPMSRM
EKMAEPPHVHHIFCTRERTGYDDLHDEFQRRNPWFSYRRLNGATHFPQLE
LPARVAEEVLGLLKAAGGNH


References
5 more
    Title: Complete Genome Sequence of Mycobacterium massiliense Clinical Strain Asan 50594, Belonging to the Type II Genotype
    Kim BJ, Kim BR, Hong SH, Seok SH, Kook YH
    Ref: Genome Announc, 1:, 2013 : PubMed

            

    Title: Whole-Genome Sequence of Mycobacterium abscessus Clinical Strain V06705
    Pang S, Renvoise A, Perret C, Guinier M, Chelghoum N, Brossier F, Capton E, Jarlier V, Sougakoff W
    Ref: Genome Announc, 1:, 2013 : PubMed

            

    Title: Genomic insights into the emerging human pathogen Mycobacterium massiliense
    Tettelin H, Sampaio EP, Daugherty SC, Hine E, Riley DR, Sadzewicz L, Sengamalay N, Shefchek K, Su Q and Zelazny AM <5 more author(s)>
    Ref: Journal of Bacteriology, 194:5450, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer