(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Terrabacteria group: NE > Actinobacteria [phylum]: NE > Actinobacteria [class]: NE > Corynebacteriales: NE > Mycobacteriaceae: NE > Mycobacterium: NE > Mycobacterium avium complex (MAC): NE > Mycobacterium avium: NE > Mycobacterium avium subsp. paratuberculosis: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Mycobacterium avium subsp. paratuberculosis K-10: N, E.
Mycobacterium avium subsp. paratuberculosis: N, E.
Mycobacterium avium subsp. paratuberculosis S397: N, E.
Mycobacterium avium subsp. paratuberculosis MAP4: N, E.
Mycobacterium avium subsp. paratuberculosis S5: N, E.
Mycobacterium avium subsp. paratuberculosis 10-4404: N, E.
Mycobacterium avium subsp. paratuberculosis 10-8425: N, E.
Mycobacterium avium subsp. paratuberculosis 08-8281: N, E.
Mycobacterium avium subsp. paratuberculosis 10-5975: N, E.
Mycobacterium avium subsp. paratuberculosis 10-5864: N, E.
Mycobacterium avium subsp. paratuberculosis 11-1786: N, E.
Mycobacterium avium: N, E.
Mycobacterium avium subsp. hominissuis TH135: N, E.
Mycobacterium avium MAV_120709_2344: N, E.
Mycobacterium avium 10-5581: N, E.
Mycobacterium avium 104: N, E.
Mycobacterium avium subsp. hominissuis: N, E.
Mycobacterium avium subsp. silvaticum: N, E.
Mycobacterium avium subsp. avium: N, E.
Mycobacterium avium MAV_061107_1842: N, E.
Mycobacterium avium subsp. hominissuis 10-5606: N, E.
Mycobacterium avium MAV_120809_2495: N, E.
Mycobacterium avium 09-5983: N, E.
Mycobacterium avium 2285 (R): N, E.
Mycobacterium tuberculosis XTB13-223: N, E.
Mycobacterium avium 05-4293: N, E.
Mycobacterium avium subsp. hominissuis 101: N, E.
Mycobacterium avium XTB13-223: N, E.
Mycobacterium avium subsp. silvaticum ATCC 49884: N, E.
Mycobacterium avium subsp. avium 10-9275: N, E.
Mycobacterium avium subsp. avium 11-4751: N, E.
Mycobacterium avium 11-0986: N, E.
Mycobacterium avium subsp. hominissuis 10-4249: N, E.
Mycobacterium avium subsp. avium 2285 (S): N, E.
Mycobacterium avium subsp. hominissuis A5: N, E.
Mycobacterium avium subsp. hominissuis 3388: N, E.
Mycobacterium avium subsp. hominissuis 100: N, E.
Mycobacterium avium subsp. avium 2285 (R): N, E.
Mycobacterium avium 10-5560: N, E.
Mycobacterium intracellulare MOTT-02: N, E.
Mycobacterium intracellulare MOTT-64: N, E.
Mycobacterium intracellulare ATCC 13950: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MNARRLARLVGISVVTTWALLSAPVGNPVAAADPCSDVSVVFARGTHQEP GLGNIGQAFVDSLTSQLGGRSVDVYAVNYPANDDYHNSANAGADDASAHV QDTVAACPNSRIVLGGYSQGSTVIDLATNAMPPSVADHVAAVALFGEPSS GFSTMLWGGQPLPTINPLYGGKTISLCAPDDPICSGGGNIMAHVSYIDAG MTAQAATFAANHLNQGSPRT
Here, we report the first complete genome sequence of the Mycobacterium intracellulare clinical strain MOTT-02, which was previously grouped in the INT2 genotype of M. intracellulare. This genome sequence will serve as a valuable reference for improving the understanding of the disparity in the virulence and epidemiologic traits between M. intracellulare genotypes.
Title: Complete genome sequence of Mycobacterium intracellulare clinical strain MOTT-64, belonging to the INT1 genotype Kim BJ, Choi BS, Lim JS, Choi IY, Kook YH Ref: Journal of Bacteriology, 194:3268, 2012 : PubMed
Here, we report the complete genome sequence of the Mycobacterium intracellulare clinical strain MOTT-64, previously grouped into the INT1 genotype among five genotypes of M. intracellulare. This genome sequence will serve as a valuable reference for understanding the disparity in the virulence and epidemiologic traits among M. intracellulare genotypes.
Here we report the first complete genome sequence of Mycobacterium intracellulare ATCC 13950(T), a Mycobacterium avium complex (MAC) strain. This genome sequence will serve as a valuable reference for understanding the epidemiologic, biological, and pathogenic aspects of the disparity between MAC members.
BACKGROUND: The genome of Mycobacterium avium subspecies paratuberculosis (MAP) is remarkably homogeneous among the genomes of bovine, human and wildlife isolates. However, previous work in our laboratories with the bovine K-10 strain has revealed substantial differences compared to sheep isolates. To systematically characterize all genomic differences that may be associated with the specific hosts, we sequenced the genomes of three U.S. sheep isolates and also obtained an optical map. RESULTS: Our analysis of one of the isolates, MAP S397, revealed a genome 4.8 Mb in size with 4,700 open reading frames (ORFs). Comparative analysis of the MAP S397 isolate showed it acquired approximately 10 large sequence regions that are shared with the human M. avium subsp. hominissuis strain 104 and lost 2 large regions that are present in the bovine strain. In addition, optical mapping defined the presence of 7 large inversions between the bovine and ovine genomes (~ 2.36 Mb). Whole-genome sequencing of 2 additional sheep strains of MAP (JTC1074 and JTC7565) further confirmed genomic homogeneity of the sheep isolates despite the presence of polymorphisms on the nucleotide level. CONCLUSIONS: Comparative sequence analysis employed here provided a better understanding of the host association, evolution of members of the M. avium complex and could help in deciphering the phenotypic differences observed among sheep and cattle strains of MAP. A similar approach based on whole-genome sequencing combined with optical mapping could be employed to examine closely related pathogens. We propose an evolutionary scenario for M. avium complex strains based on these genome sequences.
Here, we report the first complete genome sequence of the Mycobacterium intracellulare clinical strain MOTT-02, which was previously grouped in the INT2 genotype of M. intracellulare. This genome sequence will serve as a valuable reference for improving the understanding of the disparity in the virulence and epidemiologic traits between M. intracellulare genotypes.
Title: Complete genome sequence of Mycobacterium intracellulare clinical strain MOTT-64, belonging to the INT1 genotype Kim BJ, Choi BS, Lim JS, Choi IY, Kook YH Ref: Journal of Bacteriology, 194:3268, 2012 : PubMed
Here, we report the complete genome sequence of the Mycobacterium intracellulare clinical strain MOTT-64, previously grouped into the INT1 genotype among five genotypes of M. intracellulare. This genome sequence will serve as a valuable reference for understanding the disparity in the virulence and epidemiologic traits among M. intracellulare genotypes.
Here we report the first complete genome sequence of Mycobacterium intracellulare ATCC 13950(T), a Mycobacterium avium complex (MAC) strain. This genome sequence will serve as a valuable reference for understanding the epidemiologic, biological, and pathogenic aspects of the disparity between MAC members.
