Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mycgo-a85a

Mycobacterium gordonae ag85A fibronectin-binding protein A

Relationship
Family|A85-Mycolyl-transferase
Block| X
Position in NCBI Life Tree|Mycobacterium gordonae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium gordonae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : Y10378
1 UniProt : O06052
1 UniProt : O06052
1 Interpro : O06052
1 Prodom : O06052
1 Pfam : O06052
1 PIRSF : O06052
1 SUPERFAM : O06052
Sequence
Graphical view for this peptide sequence: mycgo-a85a
Colored MSA for A85-Mycolyl-transferase (raw)
MKLVDRFRGAVTGMPRRLMVGAVGAALLSGLVGFVGGSATASAFSRPGLP
VEYLQVPSAAMGRNIKIQFQSGGANSPALYLLDGMRAQDDYNGWDINTPA
FEWYNQSGISVVMPVGGQSSFYSDWYNPACGKAGCTTYKWETFLTSELPA
YLASNKQVKPTGSAAVGLSMAGSSALILAAYHPDQFVYAGSLSALLDPSQ
AMGPSLIGLAMGDAGGYKASDMWGPRGPAWQRNDPSLQVGKLVANNSRLW
IYCGDGKPSDLGGNNLPAKFLEGFVRTSNLKFQEAYNGAGGHNAVFNFDA
NGTHDWPYWGAPVQAMKGDLQSTLGATPGAGPATAAASA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKLVDRFRGAVTGMPRRLMVGAVGAALLSGLVGFVGGSATASAFSRPGLP
VEYLQVPSAAMGRNIKIQFQSGGANSPALYLLDGMRAQDDYNGWDINTPA
FEWYNQSGISVVMPVGGQSSFYSDWYNPACGKAGCTTYKWETFLTSELPA
YLASNKQVKPTGSAAVGLSMAGSSALILAAYHPDQFVYAGSLSALLDPSQ
AMGPSLIGLAMGDAGGYKASDMWGPRGPAWQRNDPSLQVGKLVANNSRLW
IYCGDGKPSDLGGNNLPAKFLEGFVRTSNLKFQEAYNGAGGHNAVFNFDA
NGTHDWPYWGAPVQAMKGDLQSTLGATPGAGPATAAASA


Reference
    Title: Cloning of the antigen 85A from Mycobacterium gordonae and its use for the specific PCR identification of these mycobacteria
    Dumonceaux M, Fauville Dufaux M, Ooms J, De Wit L, Sonck P, Content J
    Ref: Mol Cell Probes, 11:251, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer