mycit-a85b

 
Mycobacterium intracellulare complex B ag85B fibronectin-binding protein B

Relationship
Block X
Mycobacterium intracellulare position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium avium complex (MAC): N E > Mycobacterium intracellulare: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : D16546, D14253
1 UniProt : Q49575
1 UniProtTrembl : Q49575
1 Interpro : Q49575
1 Prodom : Q49575
1 Pfam : Q49575
1 PIRSF : Q49575
1 SUPERFAM : Q49575
1 QuickSwissBlast : Q49575
 
Sequence
Graphical view for this peptide sequence: mycit-a85b
Colored MSA for A85-Mycolyl-transferase (raw)
MTDLSEKVRAWGRRLVVGAAAAATLPGLIGIAGGAATANAFSRPGLPVEY
LQVPSAGMGRDIKVQFQSGGNGSPAVYLLDGLRAQDDYNGWDINTPAFEW
YYQSGLSVIMPVGGQSSFYADWYQPACGKAGCSTYKWDTFLTSELPQYLA
SNKGVKSTGSAAVGISMSGSSAMILAVNHPNQFVYAGSLSALLDPSQGMG
PSLIGLAMGDAGGYKADAMWGPSSDPAWQRNDPSLQIPALVGNNTRLWVY
CGNGTPSELGGANMPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFNANG
THSWEYWGAQLNAMKPDLQSALGASSGGGG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTDLSEKVRAWGRRLVVGAAAAATLPGLIGIAGGAATANAFSRPGLPVEY
LQVPSAGMGRDIKVQFQSGGNGSPAVYLLDGLRAQDDYNGWDINTPAFEW
YYQSGLSVIMPVGGQSSFYADWYQPACGKAGCSTYKWDTFLTSELPQYLA
SNKGVKSTGSAAVGISMSGSSAMILAVNHPNQFVYAGSLSALLDPSQGMG
PSLIGLAMGDAGGYKADAMWGPSSDPAWQRNDPSLQIPALVGNNTRLWVY
CGNGTPSELGGANMPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFNANG
THSWEYWGAQLNAMKPDLQSALGASSGGGG

no DNA




Reference
    Title: Cloning, sequencing and expression of the gene for alpha antigen from Mycobacterium intracellulare and use of PCR for the rapid identification of Mycobacterium intracellulare.
    Kitaura H, Ohara N, Matsuo T, Tasaka H, Kobayashi K, Yamada T
    Ref: Biochemical & Biophysical Research Communications, 196:1466, 1993 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer