Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mycit-h8jr40

Mycobacterium intracellulareCutinase superfamily protein

Comment
Other strains: Mycobacterium intracellulare (strain ATCC 13950 / DSM 43223 / JCM 638 / NCTC 13025 / 3600; MOTT-64; MOTT-02)


Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Mycobacterium intracellulare MOTT-64
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium avium complex (MAC): N E > Mycobacterium paraintracellulare: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : CP003324, CP003322, CP003323
1 UniProt : H8IKN8
1 UniProt : H8IKN8
1 Interpro : H8IKN8
1 Prodom : H8IKN8
1 Pfam : H8IKN8
1 PIRSF : H8IKN8
1 SUPERFAM : H8IKN8
Sequence
Graphical view for this peptide sequence: mycit-h8jr40
Colored MSA for Cutinase (raw)
MANSARRKRRRTLAWVAALSVAGVVLLVIVAVVTVLRGRESQPSAVPPGV
LPPSSTTSHPHKPRPASQDASCPDVLLVNVPGTWESAPQDDPANPLQFPN
ALLHKVTASLTQDFPASRVQAYTTPYTAQFHNPLSGDTQMSYNASRAEGT
RATVAAMTDMNTKCPLTSYVLMGFSQGAVIMGDIASDIGNGRGPVDEDLV
LGVTLIADGRRQLGVGNDIGPNPPGQGAEVTLHEVPILSGLGLTMTGARP
GGFGDLNGRTNEICAPGDLICAAPEEAFSIANLPSTLNTLAGGAAQPVHA
LYATTQCWSVDGAPATDWTLNWAHGLIANAPQPKHG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MANSARRKRRRTLAWVAALSVAGVVLLVIVAVVTVLRGRESQPSAVPPGV
LPPSSTTSHPHKPRPASQDASCPDVLLVNVPGTWESAPQDDPANPLQFPN
ALLHKVTASLTQDFPASRVQAYTTPYTAQFHNPLSGDTQMSYNASRAEGT
RATVAAMTDMNTKCPLTSYVLMGFSQGAVIMGDIASDIGNGRGPVDEDLV
LGVTLIADGRRQLGVGNDIGPNPPGQGAEVTLHEVPILSGLGLTMTGARP
GGFGDLNGRTNEICAPGDLICAAPEEAFSIANLPSTLNTLAGGAAQPVHA
LYATTQCWSVDGAPATDWTLNWAHGLIANAPQPKHG


References
    Title: Complete genome sequence of Mycobacterium intracellulare clinical strain MOTT-64, belonging to the INT1 genotype
    Kim BJ, Choi BS, Lim JS, Choi IY, Kook YH
    Ref: Journal of Bacteriology, 194:3268, 2012 : PubMed

            

    Title: Complete genome sequence of Mycobacterium intracellulare strain ATCC 13950(T)
    Kim BJ, Choi BS, Lim JS, Choi IY, Lee JH, Chun J, Kook YH
    Ref: Journal of Bacteriology, 194:2750, 2012 : PubMed

            

    Title: Complete genome sequence of Mycobacterium intracellulare clinical strain MOTT-02
    Kim BJ, Choi BS, Lim JS, Choi IY, Lee JH, Chun J, Kook YH
    Ref: Journal of Bacteriology, 194:2771, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer