Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mycit-x7t5x3

Mycobacterium intracellulare, Mycobacterium avium, Mycobacterium parascrofulaceum; Mycobacterium chimaera; Mycobacterium gordonae, Alpha/beta hydrolase fold family protein

Comment
Other strains: Mycobacterium intracellulare MIN_052511_1280; Mycobacterium avium subsp. hominissuis 100; Mycobacterium parascrofulaceum ATCC BAA-614; Mycobacterium chimaera; Mycobacterium sp. H092; Mycobacterium gordonae; Mycobacterium nebraskense; Mycobacterium chelonae; Mycobacterium scrofulaceum; Mycobacterium kubicae; Mycobacterium parmense


Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|Mycobacterium intracellulare MIN_052511_1280
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium avium complex (MAC): N E > Mycobacterium intracellulare: N E > Mycobacterium intracellulare MIN_052511_1280: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: mycit-x7t5x3
Colored MSA for Carb_B_Bacteria (raw)
MHLRTVCTTVTSGLVEGFSRDGVTRWRSIPYAEPPVGALRLRAPRPIEPW
EGVLPCHRFRYCAPQPRKYTFVGLGKYQPMSEDCLTLNVVAPDTRYERPL
PVMVFIHGGAYFLGSSATPVYDGASLARKGCVFVSVNYRLGALGAVDLSS
LSTDAFRIDDNLYLRDLVMALRWVRDNIASFGGNPDAVTIFGESAGAHAV
ATLLAVPAAKGLFAQAISESPAGGLASSREQSEEYAARFAAILGARRRDA
AAVLLTAPPTDLVATLDHLIMQESRNAPGVYPVGPTYGTDYLPLDPMDSL
RLGKAHRVPLVVGNNAEEAKLFTRFLKLLPTNEPKIELLLSTVESADRER
ITAAYPSYPKAAACIELGGDFTFASVVWQIADAHSAHAPVYVYRYDYAPR
TLRWSGLGATHATELLAVFDVYRTRLGRLLSAAGDKYTALRITEDVQSRW
CAFARTGVPGAGWPSHVSADHAVMIFDRTSRVECDPLAVRRQAWEGFTFR
RP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHLRTVCTTVTSGLVEGFSRDGVTRWRSIPYAEPPVGALRLRAPRPIEPW
EGVLPCHRFRYCAPQPRKYTFVGLGKYQPMSEDCLTLNVVAPDTRYERPL
PVMVFIHGGAYFLGSSATPVYDGASLARKGCVFVSVNYRLGALGAVDLSS
LSTDAFRIDDNLYLRDLVMALRWVRDNIASFGGNPDAVTIFGESAGAHAV
ATLLAVPAAKGLFAQAISESPAGGLASSREQSEEYAARFAAILGARRRDA
AAVLLTAPPTDLVATLDHLIMQESRNAPGVYPVGPTYGTDYLPLDPMDSL
RLGKAHRVPLVVGNNAEEAKLFTRFLKLLPTNEPKIELLLSTVESADRER
ITAAYPSYPKAAACIELGGDFTFASVVWQIADAHSAHAPVYVYRYDYAPR
TLRWSGLGATHATELLAVFDVYRTRLGRLLSAAGDKYTALRITEDVQSRW
CAFARTGVPGAGWPSHVSADHAVMIFDRTSRVECDPLAVRRQAWEGFTFR
RP



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer