mycle-MLC1351.21C

 
Mycobacterium leprae (and strain Br4923) hypothetical 109.2 kda protein

Comment
only n-term PfamA Abhydrolase_1 157 344


Relationship
Block X
Mycobacterium leprae position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium leprae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : Z95117, FM211192
2 UniProtTrembl : O05682, Q9CC34
2 Interpro : O05682, Q9CC34
2 Prodom : O05682, Q9CC34
2 Pfam : O05682, Q9CC34
2 PIRSF : O05682, Q9CC34
2 SUPERFAM : O05682, Q9CC34
2 QuickSwissBlast : O05682, Q9CC34
 
Sequence
Graphical view for this peptide sequence: mycle-MLC1351.21C
Colored MSA for PHA_synth_III_C (raw)
MCHDVQAVKSQGAAVDLNFSIVTRPVERLVATAQNGLEVLRLGGLETGSF
PSPSQIVESVPMYKLRRYFPPGNRPGQPLLGAPVLMVHPMMMSADMWDVT
REEGAVGILHVRGLDPWVIDFGSPDKVEGGMRRNLADHIVALSEAVDTVK
EVTGNDVHLVGYSQGGMFCYQAAAYRRSENIASIVAFGSPVDTLAALPMG
IPPNFGVVLANFMADHVFNRLDIPSWLARAGFQMLDPLKTVKARVDFVRQ
LHNREALLSREQQRRFLESEGWIAWSGPAISELLKQFIAHNRMMTGGFAV
NGQMVTLTDITCPVLAFVGEVDDIGQPASVRGIRRAAPNAEVYESLIRTG
HFGLVVGSRA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MCHDVQAVKSQGAAVDLNFSIVTRPVERLVATAQNGLEVLRLGGLETGSF
PSPSQIVESVPMYKLRRYFPPGNRPGQPLLGAPVLMVHPMMMSADMWDVT
REEGAVGILHVRGLDPWVIDFGSPDKVEGGMRRNLADHIVALSEAVDTVK
EVTGNDVHLVGYSQGGMFCYQAAAYRRSENIASIVAFGSPVDTLAALPMG
IPPNFGVVLANFMADHVFNRLDIPSWLARAGFQMLDPLKTVKARVDFVRQ
LHNREALLSREQQRRFLESEGWIAWSGPAISELLKQFIAHNRMMTGGFAV
NGQMVTLTDITCPVLAFVGEVDDIGQPASVRGIRRAAPNAEVYESLIRTG
HFGLVVGSRA

no DNA




References
    Title: Comparative genomic and phylogeographic analysis of Mycobacterium leprae
    Monot M, Honore N, Garnier T, Zidane N, Sherafi D, Paniz-Mondolfi A, Matsuoka M, Taylor GM, Donoghue HD and Cole ST <21 more author(s)>
    Ref: Nat Genet, 41:1282, 2009 : PubMed

            

    Title: Use of an ordered cosmid library to deduce the genomic organization of Mycobacterium leprae
    Eiglmeier K, Honore N, Woods SA, Caudron B, Cole ST
    Ref: Molecular Microbiology, 7:197, 1993 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer