mycle-PTRB

 
Mycobacterium leprae ptrb (protease II)

Relationship
Block X
Mycobacterium leprae position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium leprae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : Z95151, AL583924
1 UniProtTrembl : O05748
1 Interpro : O05748
1 Prodom : O05748
1 Pfam : O05748
1 PIRSF : O05748
1 SUPERFAM : O05748
1 QuickSwissBlast : O05748
 
Sequence
Graphical view for this peptide sequence: mycle-PTRB
Colored MSA for S9N_PREPL_Peptidase_S9 (raw)
MTKTSRGTPVPPIAKRVETRRERHGDVFFDPYEWLRDNNNPEVVAYLDAE
NDYVNQMTAHLEPLQQKIFNEIKARTKENDLSVPTRQANWWYYSRTFEGK
QYRVQCRCPVASPDDWTPPALYENTEISGEQVLLDSNAEAEGHAFFALGT
FMVSLDSNLLAYSVDFVGDERYTLRFKDLRTGERYPDEIVGIGAGATWAA
DNRTVYYLTLDESRRPDTVWRCRLGSGQPSEQVYHEADERFWLAVGLSRS
EAYIFIAAGSAITSEWRYADSTNPDAQFTVVLPRRDGIEYSVEHAPSGLV
GGQDRFLILHNDGAVNFTLVESPVSNPEQQRTLIPHRDDVRLDSADAFAG
YLVVSYRREALPRVQLWPIDPDGSYGEPEEISFESELMWVSLEANSNWVS
PKLRIRAGSFVTPVRVYDVDLATGERTLLREQPVLGGYKHEDYVERREWA
QADDGTWIPVSIVHRAAIRFPAPAVLYGYGAYEICVDPSFSIPRLSLLDR
GMMFVIAHVRGGGEMGRLWYEHGKLLEKKNTFTDFISVAKHLVDSGQTRS
QELVALGGSAGGLLMGVVANIAPDLFTGILAQVPFVDPLTTMLDPSLPLT
VTEWDEWGNPLIDSDFYSYIKSYSPYENVEAKQYPAILAMTSLHDTRVHY
VEPAKWIAALRHTKSDGNPVLLKTQMAAGHAGISGRYKAWQETAFQYAWL
LAAVDVDQYGTATEVDDLGGGAQG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTKTSRGTPVPPIAKRVETRRERHGDVFFDPYEWLRDNNNPEVVAYLDAE
NDYVNQMTAHLEPLQQKIFNEIKARTKENDLSVPTRQANWWYYSRTFEGK
QYRVQCRCPVASPDDWTPPALYENTEISGEQVLLDSNAEAEGHAFFALGT
FMVSLDSNLLAYSVDFVGDERYTLRFKDLRTGERYPDEIVGIGAGATWAA
DNRTVYYLTLDESRRPDTVWRCRLGSGQPSEQVYHEADERFWLAVGLSRS
EAYIFIAAGSAITSEWRYADSTNPDAQFTVVLPRRDGIEYSVEHAPSGLV
GGQDRFLILHNDGAVNFTLVESPVSNPEQQRTLIPHRDDVRLDSADAFAG
YLVVSYRREALPRVQLWPIDPDGSYGEPEEISFESELMWVSLEANSNWVS
PKLRIRAGSFVTPVRVYDVDLATGERTLLREQPVLGGYKHEDYVERREWA
QADDGTWIPVSIVHRAAIRFPAPAVLYGYGAYEICVDPSFSIPRLSLLDR
GMMFVIAHVRGGGEMGRLWYEHGKLLEKKNTFTDFISVAKHLVDSGQTRS
QELVALGGSAGGLLMGVVANIAPDLFTGILAQVPFVDPLTTMLDPSLPLT
VTEWDEWGNPLIDSDFYSYIKSYSPYENVEAKQYPAILAMTSLHDTRVHY
VEPAKWIAALRHTKSDGNPVLLKTQMAAGHAGISGRYKAWQETAFQYAWL
LAAVDVDQYGTATEVDDLGGGAQG

no DNA




References
    Title: Massive gene decay in the leprosy bacillus
    Cole ST, Eiglmeier K, Parkhill J, James KD, Thomson NR, Wheeler PR, Honore N, Garnier T, Churcher C and Barrell BG <34 more author(s)>
    Ref: Nature, 409:1007, 2001 : PubMed

            

    Title: Use of an ordered cosmid library to deduce the genomic organization of Mycobacterium leprae
    Eiglmeier K, Honore N, Woods SA, Caudron B, Cole ST
    Ref: Molecular Microbiology, 7:197, 1993 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer