Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mycmm-b2ht49

Mycobacterium marinum, Mycobacterium liflandii, Mycobacterium sp. Hypothetical carboxylesterase

Comment
Other strains:Mycobacterium marinum (strain ATCC BAA-535 / M; MB2; Europe; E11); Mycobacterium liflandii (strain 128FXT) Only fragment: Mycobacterium sp. 012931 Mycobacterium tuberculosis (FJ05194; Beijing/NITR203;98-R604 INH-RIF-EM; GuangZ0019; Haarlem/NITR202) Mycobacterium orygis 112400015; Mycobacterium canettii CIPT 140070008; EAI5/NITR206; Mycobacterium bovis 04-303; AN5; Mycobacterium canettii CIPT 140060008; CIPT 140070017; Mycobacterium ulcerans str. Harvey(fragment); Mycobacterium pseudoshottsii JCM 15466


Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|Mycobacterium marinum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium marinum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: mycmm-b2ht49
Colored MSA for Carb_B_Bacteria (raw)
MTSDIRRMASDGYVVETAYGPVRGAEDGIAAAGSGVRTKSWKGIRYGAPP
VGELRFRAPQPPQPWTEIADATAFGPVCPQPVLANMPIDLGAPQDEDCLR
LNIWAPANTAPGAAKPVMVWLHGGAYMLGSASQALYDGRRLASSGEVIVV
TVNYRLGALGFLDLSSLSHAGRSFDSNVGLRDVLAALHWVRENIAAFGGD
PANITLFGESAGAGLVTTLLVTPAARGLFSRAIAQSSPATSVYDRERAQR
VAVHLLDKLGVAASDVDKLTQLPTAAIVAASTEVFNEVPVRNPGTLAFVP
IVDGDVLTDYPVKVAQEGRSHPVPLLIGTNKHEAALFRLMRSPLMPITPR
AITSMFTQIAAEQPDLQLPTEEEIGLAYSRLRRRARPLSIATDVGFRMPS
VWLAEGHSRVAPVYLYRFDYSTPLLKLLLVRAAHATELPYVWGNLGGPQD
PTLRLGGAKTAKAVSKRMRTRWINFATQDNPAGPAGEPDWPAYQDGDRAC
LVIDKSDRVARDIDAPIRAAWGREVVGFR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTSDIRRMASDGYVVETAYGPVRGAEDGIAAAGSGVRTKSWKGIRYGAPP
VGELRFRAPQPPQPWTEIADATAFGPVCPQPVLANMPIDLGAPQDEDCLR
LNIWAPANTAPGAAKPVMVWLHGGAYMLGSASQALYDGRRLASSGEVIVV
TVNYRLGALGFLDLSSLSHAGRSFDSNVGLRDVLAALHWVRENIAAFGGD
PANITLFGESAGAGLVTTLLVTPAARGLFSRAIAQSSPATSVYDRERAQR
VAVHLLDKLGVAASDVDKLTQLPTAAIVAASTEVFNEVPVRNPGTLAFVP
IVDGDVLTDYPVKVAQEGRSHPVPLLIGTNKHEAALFRLMRSPLMPITPR
AITSMFTQIAAEQPDLQLPTEEEIGLAYSRLRRRARPLSIATDVGFRMPS
VWLAEGHSRVAPVYLYRFDYSTPLLKLLLVRAAHATELPYVWGNLGGPQD
PTLRLGGAKTAKAVSKRMRTRWINFATQDNPAGPAGEPDWPAYQDGDRAC
LVIDKSDRVARDIDAPIRAAWGREVVGFR


References
4 more
    Title: Draft genome sequences of two super-extensively drug-resistant isolates of Mycobacterium tuberculosis from China
    Lin N, Liu Z, Zhou J, Wang S, Fleming J
    Ref: FEMS Microbiology Letters, 347:93, 2013 : PubMed

            

    Title: Whole-Genome Sequences of Four Clinical Isolates of Mycobacterium tuberculosis from Tamil Nadu, South India
    Narayanan S, Deshpande U
    Ref: Genome Announc, 1:, 2013 : PubMed

            

    Title: Genomic analysis of smooth tubercle bacilli provides insights into ancestry and pathoadaptation of Mycobacterium tuberculosis
    Supply P, Marceau M, Mangenot S, Roche D, Rouanet C, Khanna V, Majlessi L, Criscuolo A, Tap J and Brosch R <28 more author(s)>
    Ref: Nat Genet, 45:172, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer