Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mycpa-q73u73

Mycobacterium paratuberculosis; Mycobacterium intracellulare; Mycobacterium avium subsp. paratuberculosis hypothetical protein

Comment
Other strains: Mycobacterium paratuberculosis; Mycobacterium intracellulare MOTT-02; Mycobacterium avium subsp. paratuberculosis S397


Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Mycobacterium paratuberculosis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium avium complex (MAC): N E > Mycobacterium avium: N E > Mycobacterium avium subsp. paratuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AE017239, CP003323, AFIF01000071
1 UniProt : Q73U73
1 UniProt : Q73U73
1 Interpro : Q73U73
1 Prodom : Q73U73
1 Pfam : Q73U73
1 PIRSF : Q73U73
1 SUPERFAM : Q73U73
Sequence
Graphical view for this peptide sequence: mycpa-q73u73
Colored MSA for Cutinase (raw)
MSAGHNGDMLARHVIRSLGSALVMAASGVAASAVSGSVIPTAAAQCPDVQ
VVFARGTGEAPGVGPTGQAFVDALHQRVGGRSFDVYPVNYPATDQWDTGI
DGIRDAGAHVVSMAHDCPNTKMVLGGYSQGAAVMGFVTSPAVPDGIDPAT
VPKPLTPDVANHVSSVVLFGMPNVRAMNFLGEPPVVIGPLFQDKTLKVCA
TEDPVCSDGMNFAAHDTYADDGAMIDKGVSFASSHLGLGGPGAASVASGH
GNFGE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSAGHNGDMLARHVIRSLGSALVMAASGVAASAVSGSVIPTAAAQCPDVQ
VVFARGTGEAPGVGPTGQAFVDALHQRVGGRSFDVYPVNYPATDQWDTGI
DGIRDAGAHVVSMAHDCPNTKMVLGGYSQGAAVMGFVTSPAVPDGIDPAT
VPKPLTPDVANHVSSVVLFGMPNVRAMNFLGEPPVVIGPLFQDKTLKVCA
TEDPVCSDGMNFAAHDTYADDGAMIDKGVSFASSHLGLGGPGAASVASGH
GNFGE


References
    Title: Genome sequencing of ovine isolates of Mycobacterium avium subspecies paratuberculosis offers insights into host association
    Bannantine JP, Wu CW, Hsu C, Zhou S, Schwartz DC, Bayles DO, Paustian ML, Alt DP, Sreevatsan S and Talaat AM <1 more author(s)>
    Ref: BMC Genomics, 13:89, 2012 : PubMed

            

    Title: Complete genome sequence of Mycobacterium intracellulare clinical strain MOTT-02
    Kim BJ, Choi BS, Lim JS, Choi IY, Lee JH, Chun J, Kook YH
    Ref: Journal of Bacteriology, 194:2771, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer