Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mycs2-a0r619

Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MSMEG_6394 Putative uncharacterized protein

Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Mycobacterium smegmatis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium smegmatis: N E


Molecular evidence
Database
No mutation
1 structure:
3AJA: Crystal structure of Mycobacterium smegmatis MSMEG_6394 orthologue of Rv3802c
No kinetic





1 substrate:
Cutin
1 inhbitor:
Orlistat
1 Genbank : CP000480
1 UniProt : A0R619
1 Structure : 3AJA
1 UniProt : A0R619
1 Interpro : A0R619
1 Prodom : A0R619
1 Pfam : A0R619
1 PIRSF : A0R619
1 SUPERFAM : A0R619
Sequence
Graphical view for this peptide sequence: mycs2-a0r619
Colored MSA for Cutinase (raw)
MAKNARRKRHRILALIAAAAMALVVVLVVTIVVVIMRRPDTPATPPPSAE
PPGGVVVPPGTRKPRPEFQSADCPDVMMVSIPGTWESSPTDDPFNPTQFP
LSLMSNISKPLAEQFGPDRLQVYTTPYTAQFHNPFAADKQMSYNDSRAEG
MRTTVKAMTDMNDRCPLTSYVIAGFSQGAVIAGDIASDIGNGRGPVDEDL
VLGVTLIADGRRQMGVGQDVGPNPAGQGAEITLHEVPALSALGLTMTGPR
PGGFGALDNRTNQICGSGDLICSAPEQAFSVFNLPKTLETLSGSAAGPVH
ALYNTPQFWVENGQTATQWTLEWARNLVENAPHPKHG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAKNARRKRHRILALIAAAAMALVVVLVVTIVVVIMRRPDTPATPPPSAE
PPGGVVVPPGTRKPRPEFQSADCPDVMMVSIPGTWESSPTDDPFNPTQFP
LSLMSNISKPLAEQFGPDRLQVYTTPYTAQFHNPFAADKQMSYNDSRAEG
MRTTVKAMTDMNDRCPLTSYVIAGFSQGAVIAGDIASDIGNGRGPVDEDL
VLGVTLIADGRRQMGVGQDVGPNPAGQGAEITLHEVPALSALGLTMTGPR
PGGFGALDNRTNQICGSGDLICSAPEQAFSVFNLPKTLETLSGSAAGPVH
ALYNTPQFWVENGQTATQWTLEWARNLVENAPHPKHG


Reference
    Title: Tetrahydrolipstatin inhibition, functional analyses, and three-dimensional structure of a lipase essential for mycobacterial viability
    Crellin PK, Vivian JP, Scoble J, Chow FM, West NP, Brammananth R, Proellocks NI, Shahine A, Le Nours J and Beddoe T <4 more author(s)>
    Ref: Journal of Biological Chemistry, 285:30050, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer