Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mycs2-i7gg46

Mycobacterium smegmatis Homoserine O-acetyltransferase MSMEG_6772

Comment
Other strains: Mycobacterium smegmatis (strrain ATCC 700084 / mc(2)155 ; MKD8) Mycobacterium goodii; Mycobacterium sp. SWH-M5


Relationship
Family|Homoserine_transacetylase_like_est
Block| X
Position in NCBI Life Tree|Mycobacterium smegmatis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium smegmatis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: mycs2-i7gg46
Colored MSA for Homoserine_transacetylase_like_est (raw)
MRQGLSRRHLQATTQRWRAMDEFPQDYELFDLGDVTLQHGATLRDAKLAY
KTYGELNADKSNAIVYPTWYSGRHWDNEWLIGEGKALDPAKYFIIVPNML
GNGLSTSPSNTPPPYNAARFPHVTFYDQVEVQHQLVTSFGIETLALVTGW
SMGAGQTYQWAVSYPDMVQRALPFCGSSKTSEHNIVFLEGVKSALTADAA
FKEGWYTEKPTKGIRAAARVYAGWGFSQAFYWHQEYKKMGYSSLEDFLVG
FWEGFFLDRRDPNNLLAMLWTWQNGNVGNTPGRGFHGDQVAALKTIKAKM
IVAPAEKDLYFPPEDEEFAVKHIPDAELRVIPGIYGHFAGGDANPEDNKF
IDGLVRELLAR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRQGLSRRHLQATTQRWRAMDEFPQDYELFDLGDVTLQHGATLRDAKLAY
KTYGELNADKSNAIVYPTWYSGRHWDNEWLIGEGKALDPAKYFIIVPNML
GNGLSTSPSNTPPPYNAARFPHVTFYDQVEVQHQLVTSFGIETLALVTGW
SMGAGQTYQWAVSYPDMVQRALPFCGSSKTSEHNIVFLEGVKSALTADAA
FKEGWYTEKPTKGIRAAARVYAGWGFSQAFYWHQEYKKMGYSSLEDFLVG
FWEGFFLDRRDPNNLLAMLWTWQNGNVGNTPGRGFHGDQVAALKTIKAKM
IVAPAEKDLYFPPEDEEFAVKHIPDAELRVIPGIYGHFAGGDANPEDNKF
IDGLVRELLAR



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer