Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: myctu-MT3441

Mycobacterium tuberculosis and Mycobacterium bovis CDC1551 RV3337 RV3338 MT3441 hypothetical protein

Comment
RV3337 O53387 and RV3338 MT3441 O53388 are two adjascent genes of M tuberculosis homologous with only one M bovis gene. Either it is an interrupted gene or these genes are only one gene. These are grouped in ESTHER in one single entry


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Mycobacterium tuberculosis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: myctu-MT3441
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MPSPSTTGHHAACGTGGTGFSVGSMRSPIRVGSGEPVLLLHPFLMSQTVW
EKVAQQLADTGRFEVFAPTMAGHNGGPASGTRVLSSAVLADHVERQLDEL
GWETSHIVGNSLGGWVAFELERRGRARSVTGIAPAGGWTRWSPVKFEVIA
KFIAGAPILAVAHILGQRALRLPFSRLLATLPISATPDGVSERELSGIID
DAAHCPAYFQLLVKALVLPGLQELEHTAVPSHVVLCEQDRVVPPSRFSRH
FTDSLPAGHRLTVLDGVGHVPMFEAPGRITELITSFIEECCPHVRAS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPSPSTTGHHAACGTGGTGFSVGSMRSPIRVGSGEPVLLLHPFLMSQTVW
EKVAQQLADTGRFEVFAPTMAGHNGGPASGTRVLSSAVLADHVERQLDEL
GWETSHIVGNSLGGWVAFELERRGRARSVTGIAPAGGWTRWSPVKFEVIA
KFIAGAPILAVAHILGQRALRLPFSRLLATLPISATPDGVSERELSGIID
DAAHCPAYFQLLVKALVLPGLQELEHTAVPSHVVLCEQDRVVPPSRFSRH
FTDSLPAGHRLTVLDGVGHVPMFEAPGRITELITSFIEECCPHVRAS


References
3 more
    Title: EphH, a unique epoxide hydrolase encoded by Rv3338 is involved in the survival of Mycobacterium tuberculosis under in vitro stress and vacuolar pH-induced changes
    Garg T, Das S, Singh S, Imran M, Mukhopadhyay A, Gupta UD, Chopra S, Dasgupta A
    Ref: Front Microbiol, 13:1092131, 2023 : PubMed

            

    Title: The alpha/beta Hydrolase Fold Proteins of Mycobacterium tuberculosis, With Reference to their Contribution to Virulence
    Johnson G
    Ref: Curr Protein Pept Sci, 18:190, 2016 : PubMed

            

    Title: The complete genome sequence of Mycobacterium bovis
    Garnier T, Eiglmeier K, Camus JC, Medina N, Mansoor H, Pryor M, Duthoy S, Grondin S, Lacroix C and Hewinson RG <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:7877, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer