myctu-PKS13

 
Mycobacterium tuberculosis, Mycobacterium bovis, polyketide synthase Thioesterase domain (PKS13 Rv3800c MT3907)

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Block X
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
8 structures (e.g. : 5V3X, 5V3Y, 5V40... more)
No kinetic


Inhibitor: Z3J-Cmpd6-7M7V , TAM1 , TAM16 , TAM6 , TAM5 , Polypropyleneglycol-fragment-C8 , TAM3 ,
>3 Genbank links 19 more: BX248347, AL022076, AE007184
3 UniProt : O53579, A5U9C9, I6X8D2
>3 Structure links 5 more: 5V3X, 5V3Y, 5V40
3 UniProtTrembl : O53579, A5U9C9, I6X8D2
3 Interpro : O53579, A5U9C9, I6X8D2
3 Prodom : O53579, A5U9C9, I6X8D2
3 Pfam : O53579, A5U9C9, I6X8D2
3 PIRSF : O53579, A5U9C9, I6X8D2
3 SUPERFAM : O53579, A5U9C9, I6X8D2
3 QuickSwissBlast : O53579, A5U9C9, I6X8D2
 
Sequence
Graphical view for this peptide sequence: myctu-PKS13
Colored MSA for Thioesterase (raw)
VPVFVFHPAGGSTVVYEPLLGRLPADTPMYGFERVEGSIEERAQQYVPKL
IEMQGDGPYVLVGWSLGGVLAYACAIGLRRLGKDVRFVGLIDAVRAGEEI
PQTKEEIRKRWDRYAAFAEKTFNVTIPAIPYEQLEELDDEGQVRFVLDAV
SQSGVQIPAGIIEHQRTSYLDNRAIDTAQIQPYDGHVTLYMADRYHDDAI
MFEPRYAVRQPDGGWGEYVSDLEVVPIGGEHIQAIDEPIIAKVGEHMSRA
LGQIEADRTSEVGKQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

VPVFVFHPAGGSTVVYEPLLGRLPADTPMYGFERVEGSIEERAQQYVPKL
IEMQGDGPYVLVGWSLGGVLAYACAIGLRRLGKDVRFVGLIDAVRAGEEI
PQTKEEIRKRWDRYAAFAEKTFNVTIPAIPYEQLEELDDEGQVRFVLDAV
SQSGVQIPAGIIEHQRTSYLDNRAIDTAQIQPYDGHVTLYMADRYHDDAI
MFEPRYAVRQPDGGWGEYVSDLEVVPIGGEHIQAIDEPIIAKVGEHMSRA
LGQIEADRTSEVGKQ

no DNA




References
16 more
    Title: Optimization of TAM16, a Benzofuran That Inhibits the Thioesterase Activity of Pks13; Evaluation toward a Preclinical Candidate for a Novel Antituberculosis Clinical Target
    Wilson C, Ray P, Zuccotto F, Hernandez J, Aggarwal A, Mackenzie C, Caldwell N, Taylor M, Huggett M and Wyatt PG <30 more author(s)>
    Ref: Journal of Medicinal Chemistry, 65:409, 2022 : PubMed

            

    Title: Development of a Novel Lead that Targets M. tuberculosis Polyketide Synthase 13
    Aggarwal A, Parai MK, Shetty N, Wallis D, Woolhiser L, Hastings C, Dutta NK, Galaviz S, Dhakal RC and Sacchettini JC <20 more author(s)>
    Ref: Cell, 170:249, 2017 : PubMed

            

    Title: Synthesis and evaluation of new 2-aminothiophenes against Mycobacterium tuberculosis
    Thanna S, Knudson SE, Grzegorzewicz A, Kapil S, Goins CM, Ronning DR, Jackson M, Slayden RA, Sucheck SJ
    Ref: Org Biomol Chem, 14:6119, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer