Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: myctu-PKS6

Mycobacterium tuberculosis and Mycobacterium bovis pks6 (polyketide synthase)Thioesterase domain Rv0405 MT0418

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Mycobacterium tuberculosis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: BX248335, Z84725, AE006946
3 UniProt : O86335, Q7D9V6, A5TZD1
3 UniProt : O86335, Q7D9V6, A5TZD1
3 Interpro : O86335, Q7D9V6, A5TZD1
3 Prodom : O86335, Q7D9V6, A5TZD1
3 Pfam : O86335, Q7D9V6, A5TZD1
3 PIRSF : O86335, Q7D9V6, A5TZD1
3 SUPERFAM : O86335, Q7D9V6, A5TZD1
Sequence
Graphical view for this peptide sequence: myctu-PKS6
Colored MSA for Thioesterase (raw)
PTELAQYLITQIDGHGSSAAAAANPAERIDALTDLFLQACDAGRDADGWK
MVALASNTRERMSSPVRNNVSKNVALLADGISDVVVICIPTLTVLSDQRE
YRDIANAMTGRHSVYSLTLPGFDSSDALPQNADMIVETVSNAIIDVVGGS
CRFVLSGYSSGGVLAYALCSHLSVKHQRNPLGVALIDTYLPSQIANPSMN
EGFSPNDTGKGLSREVIRVARMLNRLTATRLTAAATYAAIFQAWEPGRSM
APVLNIVAKDRIATVENLREERINRWRTAAAEAAYSVAEVPGDHFGMMST
SSEAIATEIHDWISGLVRGPHR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

PTELAQYLITQIDGHGSSAAAAANPAERIDALTDLFLQACDAGRDADGWK
MVALASNTRERMSSPVRNNVSKNVALLADGISDVVVICIPTLTVLSDQRE
YRDIANAMTGRHSVYSLTLPGFDSSDALPQNADMIVETVSNAIIDVVGGS
CRFVLSGYSSGGVLAYALCSHLSVKHQRNPLGVALIDTYLPSQIANPSMN
EGFSPNDTGKGLSREVIRVARMLNRLTATRLTAAATYAAIFQAWEPGRSM
APVLNIVAKDRIATVENLREERINRWRTAAAEAAYSVAEVPGDHFGMMST
SSEAIATEIHDWISGLVRGPHR


References
3 more
    Title: The complete genome sequence of Mycobacterium bovis
    Garnier T, Eiglmeier K, Camus JC, Medina N, Mansoor H, Pryor M, Duthoy S, Grondin S, Lacroix C and Hewinson RG <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:7877, 2003 : PubMed

            

    Title: Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains
    Fleischmann RD, Alland D, Eisen JA, Carpenter L, White O, Peterson J, Deboy R, Dodson R, Gwinn M and Fraser CM <16 more author(s)>
    Ref: Journal of Bacteriology, 184:5479, 2002 : PubMed

            

    Title: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence
    Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S and Barrell BG <32 more author(s)>
    Ref: Nature, 393:537, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer