myctu-RV0457C

 
Mycobacterium tuberculosis and Mycobacterium bovis prolyl oligopeptidase family protein 74.5 kda RV0457C

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Block X
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



3 Genbank : Z96796, BX248335, AE000516
3 UniProt : Q7D9S4, O07178, A5TZI4
3 UniProtTrembl : O07178, Q7D9S4, A5TZI4
3 Interpro : O07178, Q7D9S4, A5TZI4
3 Prodom : O07178, Q7D9S4, A5TZI4
3 Pfam : O07178, Q7D9S4, A5TZI4
3 PIRSF : O07178, Q7D9S4, A5TZI4
3 SUPERFAM : O07178, Q7D9S4, A5TZI4
3 QuickSwissBlast : O07178, Q7D9S4, A5TZI4
 
Sequence
Graphical view for this peptide sequence: myctu-RV0457C
Colored MSA for S9N_PPCE_Peptidase_S9 (raw)
MTFEPAPDGADPYLWLEDVTGAEALDWVRARNKPTTAAFCDAEFERMRVE
ALEVLDTDARIPYVNRRGNYLYNFWRDAANPRGLWRRTTLDSYRTDSPGW
DVLIDVDELGRADDQKWVWGGAGVIEPDYTRALIGLSPGGSDASIVREFD
MLTREFVEDGFQLPPAKSQITWEDPDTVLLGTDFGGDSLTTSGYPRVIKR
WRRGKPLADAETIFEGAGTDVRVNASADRTPGFERTLLGRALDFWNEEVY
ELRGSELIRIEAPTDASVSIHRDWLLIELRTDWTVATTRYTAGSLLAAEY
DEFLAGSAELQVVFEPDEHTALYQYAWTRDRLLIVTLADVASRVEIATPG
SWRREPLSGIPAATNTVIVSADSHGDEFFLDSSGFDTPSRLMRGTDDGRL
AEIKSAPAFFDAENMAVTQYFATSDDGTSIPYFVVRRTDADNPGPTLLNG
YGGFETSRTPTYDGVLGRLWLARGGTYALANIRGGGEYGPGWHTQAMREG
RDKVAQDFAAVATDLVTRGITTAEQLGARGGSNGGLLMGIMLTGYPEKFG
ALVCDVPLLDMKRYHLLLAGASWMAEYGDPDNPDDWKFISEYSPYQNISA
NRKYPPVLMTTSTRDDRVHPGHARKMTAALQAAGHPVWYYENIEGGHAGA
ADNAQIAFKSALSFAFLWRMLAG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTFEPAPDGADPYLWLEDVTGAEALDWVRARNKPTTAAFCDAEFERMRVE
ALEVLDTDARIPYVNRRGNYLYNFWRDAANPRGLWRRTTLDSYRTDSPGW
DVLIDVDELGRADDQKWVWGGAGVIEPDYTRALIGLSPGGSDASIVREFD
MLTREFVEDGFQLPPAKSQITWEDPDTVLLGTDFGGDSLTTSGYPRVIKR
WRRGKPLADAETIFEGAGTDVRVNASADRTPGFERTLLGRALDFWNEEVY
ELRGSELIRIEAPTDASVSIHRDWLLIELRTDWTVATTRYTAGSLLAAEY
DEFLAGSAELQVVFEPDEHTALYQYAWTRDRLLIVTLADVASRVEIATPG
SWRREPLSGIPAATNTVIVSADSHGDEFFLDSSGFDTPSRLMRGTDDGRL
AEIKSAPAFFDAENMAVTQYFATSDDGTSIPYFVVRRTDADNPGPTLLNG
YGGFETSRTPTYDGVLGRLWLARGGTYALANIRGGGEYGPGWHTQAMREG
RDKVAQDFAAVATDLVTRGITTAEQLGARGGSNGGLLMGIMLTGYPEKFG
ALVCDVPLLDMKRYHLLLAGASWMAEYGDPDNPDDWKFISEYSPYQNISA
NRKYPPVLMTTSTRDDRVHPGHARKMTAALQAAGHPVWYYENIEGGHAGA
ADNAQIAFKSALSFAFLWRMLAG

no DNA




References
4 more
    Title: Mycobacterium tuberculosis Prolyl Oligopeptidase Induces In vitro Secretion of Proinflammatory Cytokines by Peritoneal Macrophages
    Portugal B, Motta FN, Correa AF, Nolasco DO, De Almeida H, Magalhaes KG, Atta AL, Vieira FD, Bastos IM, Santana JM
    Ref: Front Microbiol, 8:155, 2017 : PubMed

            

    Title: The complete genome sequence of Mycobacterium bovis
    Garnier T, Eiglmeier K, Camus JC, Medina N, Mansoor H, Pryor M, Duthoy S, Grondin S, Lacroix C and Hewinson RG <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:7877, 2003 : PubMed

            

    Title: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence
    Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S and Barrell BG <32 more author(s)>
    Ref: Nature, 393:537, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer