myctu-RV1639C

 
Mycobacterium tuberculosis, Mycobacterium bovis, hypothetical protein rv1639c

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Block X
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 9 more: AM408590, AP010918, DS016976
2 UniProt : A5U2Z6, P94973
2 UniProtTrembl : A5U2Z6, P94973
2 Interpro : A5U2Z6, P94973
2 Prodom : A5U2Z6, P94973
2 Pfam : A5U2Z6, P94973
2 PIRSF : A5U2Z6, P94973
2 SUPERFAM : A5U2Z6, P94973
2 QuickSwissBlast : A5U2Z6, P94973
 
Sequence
Graphical view for this peptide sequence: myctu-RV1639C
Colored MSA for A85-Est-Putative (raw)
MAQNELVTASTPPAATQPLAVGHTSLMHGWVPLAVQVVTAVVLVLAAGWR
SRHWQRRWLPTAAAIGATLAWGTRWYVTGNGLANERPPSTLWIWVALTGA
AATVLILGWRSARWWRRGASLLAVPLCLLSATLTLNLWVGYFPTVQTAWN
QLTSGPLPDQADQAAVAALAHSGVRPSHGTLLPVVIPSDASHFKHRGELV
YLPPAWFDREHRSENPPPPQLPTVMMIGGQFNTPADWARAGNAVKTLDDF
AAAHSGNAPVVVFVDSGGAFNNDTECVNGRRGNAADHLTKDVVPYMVSKF
GVSPEQTSWGIVGWSMGGTCAVDLTVMHPTLFSAFVDIAGDFYPNAGNKT
QTIVRLFGGNEDAWSAFDPTTVITRHGSYTGLSGWFAISSPGPPSPDNAV
ADTTTMRLAGRDAAANPGNQAAAANALCALGRANGIYCAVVPQPGKHDWP
FADRVFAAALPWLAGQLATPGVPKIPLPGTTQQIAGTGR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAQNELVTASTPPAATQPLAVGHTSLMHGWVPLAVQVVTAVVLVLAAGWR
SRHWQRRWLPTAAAIGATLAWGTRWYVTGNGLANERPPSTLWIWVALTGA
AATVLILGWRSARWWRRGASLLAVPLCLLSATLTLNLWVGYFPTVQTAWN
QLTSGPLPDQADQAAVAALAHSGVRPSHGTLLPVVIPSDASHFKHRGELV
YLPPAWFDREHRSENPPPPQLPTVMMIGGQFNTPADWARAGNAVKTLDDF
AAAHSGNAPVVVFVDSGGAFNNDTECVNGRRGNAADHLTKDVVPYMVSKF
GVSPEQTSWGIVGWSMGGTCAVDLTVMHPTLFSAFVDIAGDFYPNAGNKT
QTIVRLFGGNEDAWSAFDPTTVITRHGSYTGLSGWFAISSPGPPSPDNAV
ADTTTMRLAGRDAAANPGNQAAAANALCALGRANGIYCAVVPQPGKHDWP
FADRVFAAALPWLAGQLATPGVPKIPLPGTTQQIAGTGR

no DNA




References
3 more
    Title: Whole genome sequence analysis of Mycobacterium bovis bacillus Calmette-Guerin (BCG) Tokyo 172: a comparative study of BCG vaccine substrains
    Seki M, Honda I, Fujita I, Yano I, Yamamoto S, Koyama A
    Ref: Vaccine, 27:1710, 2009 : PubMed

            

    Title: Genome plasticity of BCG and impact on vaccine efficacy
    Brosch R, Gordon SV, Garnier T, Eiglmeier K, Frigui W, Valenti P, Dos Santos S, Duthoy S, Lacroix C and Cole ST <10 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 104:5596, 2007 : PubMed

            

    Title: The complete genome sequence of Mycobacterium bovis
    Garnier T, Eiglmeier K, Camus JC, Medina N, Mansoor H, Pryor M, Duthoy S, Grondin S, Lacroix C and Hewinson RG <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:7877, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer