myctu-RV1683

 
Mycobacterium tuberculosis, Mycobacterium bovis, Mycobacterium marinum, Mycobacterium ulcerans,107.4 kda protein dehydrogenase (EC 6.2.1.-) long-chain Acyl-CoA synthetase RV1683

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains only n-term PfamA Abhydrolase_1 128 331


Relationship
Block X
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 32 more: Z98268, AP010918, CP001658
>3 UniProt links 2 more: Q7D856, A5U341, B2HR42
>3 UniProtTrembl links 2 more: O33185, Q7D856, A5U341
>3 Interpro links 2 more: O33185, Q7D856, A5U341
>3 Prodom links 2 more: O33185, Q7D856, A5U341
>3 Pfam links 2 more: O33185, Q7D856, A5U341
>3 PIRSF links 2 more: O33185, Q7D856, A5U341
>3 SUPERFAM links 2 more: O33185, Q7D856, A5U341
>3 QuickSwissBlast links 2 more: O33185, Q7D856, A5U341
 
Sequence
Graphical view for this peptide sequence: myctu-RV1683
Colored MSA for PHA_synth_III_C (raw)
MVDLNFSMVTRPIERLVATAQNGLEVLRLGGLETGSVPSPSQIVESVPMY
KLRRYFPPDNRPGQPPVGPPVLMVHPMMMSADMWDVTREDGAVGILHASG
LDPWVIDFGSPDEVEGGMRRNLADHIVALSEAVDTVKDATGHDVHFVGYS
QGGMFCYQAAAYRRSKDIASVVAFGSPVDTLAALPMGIPANMGAAVADFM
ADHVFNRLDIPSWMARMGFQMMDPLKTAKARVDFVRQLHDREALLPREQQ
RRFLESEGWIAWSGPAISELLKQFIAHNRMMTGGFAISGQMVTLTDITCP
ILAFVGEVDDIGQPASVRGIRRAAPNSEVYECLIRAGHFGLVVGSRAAQQ
SWPTVADWVR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVDLNFSMVTRPIERLVATAQNGLEVLRLGGLETGSVPSPSQIVESVPMY
KLRRYFPPDNRPGQPPVGPPVLMVHPMMMSADMWDVTREDGAVGILHASG
LDPWVIDFGSPDEVEGGMRRNLADHIVALSEAVDTVKDATGHDVHFVGYS
QGGMFCYQAAAYRRSKDIASVVAFGSPVDTLAALPMGIPANMGAAVADFM
ADHVFNRLDIPSWMARMGFQMMDPLKTAKARVDFVRQLHDREALLPREQQ
RRFLESEGWIAWSGPAISELLKQFIAHNRMMTGGFAISGQMVTLTDITCP
ILAFVGEVDDIGQPASVRGIRRAAPNSEVYECLIRAGHFGLVVGSRAAQQ
SWPTVADWVR

no DNA




References
6 more
    Title: Small-Molecule Probes Reveal Esterases with Persistent Activity in Dormant and Reactivating Mycobacterium tuberculosis
    Tallman KR, Levine SR, Beatty KE
    Ref: ACS Infect Dis, 2:936, 2016 : PubMed

            

    Title: Whole genome sequence analysis of Mycobacterium bovis bacillus Calmette-Guerin (BCG) Tokyo 172: a comparative study of BCG vaccine substrains
    Seki M, Honda I, Fujita I, Yano I, Yamamoto S, Koyama A
    Ref: Vaccine, 27:1710, 2009 : PubMed

            

    Title: Genome plasticity of BCG and impact on vaccine efficacy
    Brosch R, Gordon SV, Garnier T, Eiglmeier K, Frigui W, Valenti P, Dos Santos S, Duthoy S, Lacroix C and Cole ST <10 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 104:5596, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer