myctu-RV2627C

 
Mycobacterium tuberculosis; Mycobacterium bovis; hypothetical protein rv2627c/MT2702

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains . Only c-term Pfam Abhydrolase_1


Relationship
Block X
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 11 more: BX842580, AE000516, Z95387
3 UniProt : P9WL66, P9WL67, A5U5X8
3 UniProtTrembl : P9WL66, P9WL67, A5U5X8
3 Interpro : P9WL66, P9WL67, A5U5X8
3 Prodom : P9WL66, P9WL67, A5U5X8
3 Pfam : P9WL66, P9WL67, A5U5X8
3 PIRSF : P9WL66, P9WL67, A5U5X8
3 SUPERFAM : P9WL66, P9WL67, A5U5X8
3 QuickSwissBlast : P9WL66, P9WL67, A5U5X8
 
Sequence
Graphical view for this peptide sequence: myctu-RV2627C
Colored MSA for 6_AlphaBeta_hydrolase (raw)
RSFYRIFFDSGFTPHPGEPGSQRWLSYTANNREYALLLRHPEPRPWLVCV
HGTEMGRAPLDLAVFRAWKLHDELGLNIVMPVLPMHGPRGQGLPKGAVFP
GEDVLDDVHGTAQAVWDIRRLLSWIRSQEEESLIGLNGLSLGGYIASLVA
SLEEGLACAILGVPVADLIELLGRHCGLRHKDPRRHTVKMAEPIGRMISP
LSLTPLVPMPGRFIYAGIADRLVHPREQVTRLWEHWGKPEIVWYPGGHTG
FFQSRPVRRFVQAALEQSGLLDAPRTQRDRSA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

RSFYRIFFDSGFTPHPGEPGSQRWLSYTANNREYALLLRHPEPRPWLVCV
HGTEMGRAPLDLAVFRAWKLHDELGLNIVMPVLPMHGPRGQGLPKGAVFP
GEDVLDDVHGTAQAVWDIRRLLSWIRSQEEESLIGLNGLSLGGYIASLVA
SLEEGLACAILGVPVADLIELLGRHCGLRHKDPRRHTVKMAEPIGRMISP
LSLTPLVPMPGRFIYAGIADRLVHPREQVTRLWEHWGKPEIVWYPGGHTG
FFQSRPVRRFVQAALEQSGLLDAPRTQRDRSA

no DNA




References
8 more
    Title: Mycobacterium tuberculosis senses host-derived carbon monoxide during macrophage infection
    Shiloh MU, Manzanillo P, Cox JS
    Ref: Cell Host Microbe, 3:323, 2008 : PubMed

            

    Title: Human T-cell responses to 25 novel antigens encoded by genes of the dormancy regulon of Mycobacterium tuberculosis
    Leyten EM, Lin MY, Franken KL, Friggen AH, Prins C, van Meijgaarden KE, Voskuil MI, Weldingh K, Andersen P and Klein MR <3 more author(s)>
    Ref: Microbes Infect, 8:2052, 2006 : PubMed

            

    Title: Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program
    Voskuil MI, Schnappinger D, Visconti KC, Harrell MI, Dolganov GM, Sherman DR, Schoolnik GK
    Ref: J Exp Med, 198:705, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer