myctu-RV3724

 
Mycobacterium tuberculosis cut5 (a; b) and Mycobacterium bovis RV3724 putative cutinase precursor MT3827

Comment
This is probably a pseudo gene. Gene in two fragments RV3724A and B here the sequence is a partial concatenation of the two. There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family Cutinase
Block X
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 16 more: BX248347, AL022121, AE000516
>3 UniProt links 1 more: Q7D4Z9, Q79FA4, A5U951
>3 UniProtTrembl links 2 more: Q7D4Z9, Q79FA4, Q79FA5
>3 Interpro links 2 more: Q7D4Z9, Q79FA4, Q79FA5
>3 Prodom links 2 more: Q7D4Z9, Q79FA4, Q79FA5
>3 Pfam links 2 more: Q7D4Z9, Q79FA4, Q79FA5
>3 PIRSF links 2 more: Q7D4Z9, Q79FA4, Q79FA5
>3 SUPERFAM links 2 more: Q7D4Z9, Q79FA4, Q79FA5
>3 QuickSwissBlast links 2 more: Q7D4Z9, Q79FA4, Q79FA5
 
Sequence
Graphical view for this peptide sequence: myctu-RV3724
Colored MSA for Cutinase (raw)
MDVIRWARRLAVVAGTAAAVTTPGLLSAHVPMVSAEPCPDVEVVFARGTG
EPPGIGSVGGLFVDALRSQVGAKSLGVYAVNYPASNDFASSDFPKTVIDG
IRDAGSHIQSMAMSCPQTRQVLGGYSQGAAVAGYVTSAVVPPAVPVQAVP
APMAPEVANHVAAVTLFGAPSAQFLGQYGAPPIAIGPLYQPKTLQLCADG
DSICGDGNSPVAHGLYAVNGMVGQGANFAASRL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDVIRWARRLAVVAGTAAAVTTPGLLSAHVPMVSAEPCPDVEVVFARGTG
EPPGIGSVGGLFVDALRSQVGAKSLGVYAVNYPASNDFASSDFPKTVIDG
IRDAGSHIQSMAMSCPQTRQVLGGYSQGAAVAGYVTSAVVPPAVPVQAVP
APMAPEVANHVAAVTLFGAPSAQFLGQYGAPPIAIGPLYQPKTLQLCADG
DSICGDGNSPVAHGLYAVNGMVGQGANFAASRL

no DNA




References
16 more
    Title: The complete genome sequence of Mycobacterium bovis
    Garnier T, Eiglmeier K, Camus JC, Medina N, Mansoor H, Pryor M, Duthoy S, Grondin S, Lacroix C and Hewinson RG <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:7877, 2003 : PubMed

            

    Title: Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains
    Fleischmann RD, Alland D, Eisen JA, Carpenter L, White O, Peterson J, Deboy R, Dodson R, Gwinn M and Fraser CM <16 more author(s)>
    Ref: Journal of Bacteriology, 184:5479, 2002 : PubMed

            

    Title: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence
    Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S and Barrell BG <32 more author(s)>
    Ref: Nature, 393:537, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer